![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | maker-scaffold01061-augustus-gene-0.30-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 188aa MW: 21742.5 Da PI: 5.889 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 134 | 1e-41 | 8 | 128 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskr 64 lppGfrF Ptdeelvv++L++k++ +++ ++i+++d++ ++Pw+L+ k+ ae ++wyf+s++ maker-scaffold01061-augustus-gene-0.30-mRNA-1 8 LPPGFRFYPTDEELVVHFLHRKATLLPCHP-DIIPDLDLFPHDPWELDGKALAEGNKWYFYSRK 70 79*************************999.99**************977778899******98 PP NAM 65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ ++nr+t++gyWk g +++v++++g++vg+kk Lvfy g+ap+++kt+W+mheyrl maker-scaffold01061-augustus-gene-0.30-mRNA-1 71 AQ------NSNRITSNGYWKPMGIEEPVMNSNGKKVGIKKHLVFYVGEAPSSVKTNWIMHEYRL 128 76......579***************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.96E-50 | 4 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 47.666 | 8 | 159 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.6E-24 | 9 | 128 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MAENNVNLPP GFRFYPTDEE LVVHFLHRKA TLLPCHPDII PDLDLFPHDP WELDGKALAE 60 GNKWYFYSRK AQNSNRITSN GYWKPMGIEE PVMNSNGKKV GIKKHLVFYV GEAPSSVKTN 120 WIMHEYRLSE TSSSSRSSKR RGHPKMDYSK WVICRVYERD EDGDGTELSC LDEVYLSLDD 180 LDEISFPN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 3e-46 | 4 | 164 | 16 | 173 | NAC domain-containing protein 19 |
3swm_B | 3e-46 | 4 | 164 | 16 | 173 | NAC domain-containing protein 19 |
3swm_C | 3e-46 | 4 | 164 | 16 | 173 | NAC domain-containing protein 19 |
3swm_D | 3e-46 | 4 | 164 | 16 | 173 | NAC domain-containing protein 19 |
3swp_A | 3e-46 | 4 | 164 | 16 | 173 | NAC domain-containing protein 19 |
3swp_B | 3e-46 | 4 | 164 | 16 | 173 | NAC domain-containing protein 19 |
3swp_C | 3e-46 | 4 | 164 | 16 | 173 | NAC domain-containing protein 19 |
3swp_D | 3e-46 | 4 | 164 | 16 | 173 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023900455.1 | 1e-124 | NAC domain-containing protein 104-like isoform X1 | ||||
Swissprot | Q8GWK6 | 9e-80 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A2I4GDM6 | 1e-101 | A0A2I4GDM6_JUGRE; NAC domain-containing protein 104 isoform X1 | ||||
STRING | XP_010103879.1 | 8e-97 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1736 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 2e-79 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|