PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | maker-scaffold00281-snap-gene-0.36-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 168aa MW: 19267.8 Da PI: 10.4443 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 106 | 2e-33 | 89 | 147 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s+fprsYYrCt++gC+vkk+++r ++d++vv++tYeg H h+ maker-scaffold00281-snap-gene-0.36-mRNA-1 89 LDDGYRWRKYGQKAVKNSKFPRSYYRCTHKGCNVKKQIQRLSKDEEVVVTTYEGMHSHP 147 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.9E-33 | 74 | 147 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.1E-29 | 81 | 148 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.884 | 84 | 149 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.6E-38 | 89 | 148 | IPR003657 | WRKY domain |
Pfam | PF03106 | 6.5E-27 | 90 | 147 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MAPMQNNQML LLGSSSSSAV STSSLNIENF NSQNFFHGAN KKDKMKVETR IQHHEANNIS 60 EGGGKVTKGD KKIRRHRFAF HTRSHVDILD DGYRWRKYGQ KAVKNSKFPR SYYRCTHKGC 120 NVKKQIQRLS KDEEVVVTTY EGMHSHPLEK TTDSFEQILK QLQTPAPS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-27 | 79 | 148 | 7 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 2e-27 | 79 | 148 | 7 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023894525.1 | 1e-103 | probable WRKY transcription factor 43 | ||||
Swissprot | Q9FYA2 | 2e-49 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | Q5IZC7 | 2e-60 | Q5IZC7_VITVI; WRKY-type DNA binding protein 1 | ||||
STRING | VIT_17s0000g01280.t01 | 4e-61 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 3e-51 | WRKY DNA-binding protein 75 |