 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
gw1.12.608.1 |
| Common Name | CHLNCDRAFT_17734 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
|
| Family |
NF-YB |
| Protein Properties |
Length: 93aa MW: 10774.3 Da PI: 5.2518 |
| Description |
NF-YB family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| gw1.12.608.1 | genome | JGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NF-YB | 175.2 | 6.7e-55 | 1 | 93 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
reqdrflPian+srimkk lP+naki+kdaketvqec sefisf+tseasdkcqre+rktingddllwa++tlGf++yveplk yl+k+re+e
gw1.12.608.1 1 REQDRFLPIANISRIMKKSLPGNAKIAKDAKETVQECLSEFISFITSEASDKCQRERRKTINGDDLLWAMTTLGFDEYVEPLKEYLAKFREAE 93
79****************************************************************************************986 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AK357982 | 4e-67 | AK357982.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1066F22. |
| GenBank | AK364176 | 4e-67 | AK364176.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2022G14. |
| GenBank | AK367478 | 4e-67 | AK367478.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2057P16. |
| GenBank | AK370727 | 4e-67 | AK370727.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2116A18. |
| GenBank | BT009078 | 4e-67 | BT009078.1 Triticum aestivum clone wkm1c.pk0002.d7:fis, full insert mRNA sequence. |
| GenBank | GU902786 | 4e-67 | GU902786.1 Triticum monococcum nuclear transcription factor Y subunit B2 mRNA, partial cds. |
| GenBank | JF764604 | 4e-67 | JF764604.1 Hordeum vulgare NF-YB5 mRNA, complete cds. |
| GenBank | KM078735 | 4e-67 | KM078735.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-A2) mRNA, complete cds. |
| GenBank | KM078736 | 4e-67 | KM078736.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-B2) mRNA, complete cds. |
| GenBank | KM078737 | 4e-67 | KM078737.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D2) mRNA, complete cds. |
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Blanc G, et al.
The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
Plant Cell, 2010. 22(9): p. 2943-55
[PMID:20852019] - Han X, et al.
Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis.
J. Exp. Bot., 2013. 64(14): p. 4589-601
[PMID:24006421] - Kim SK, et al.
OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice.
Planta, 2016. 243(3): p. 563-76
[PMID:26542958] - Hwang YH, et al.
Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
Plant Cell Rep., 2016. 35(4): p. 857-65
[PMID:26754793] - Hossain MA, et al.
Identification of Novel Components of the Unfolded Protein Response in Arabidopsis.
Front Plant Sci, 2016. 7: p. 650
[PMID:27242851] - Zhao H, et al.
The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
Front Plant Sci, 2016. 7: p. 2045
[PMID:28119722]
|
