PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea

Family

WRKY

Protein Properties

Length: 171aa MW: 19107.2 Da PI: 10.4012

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gw1.1.725.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	86	3.4e-27	2	59	2	59
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 dDgy+WrKYG K+vkgs++prsYY+C++++C+vkk ver+ e+++v + +g Hnh gw1.1.725.1 2 DDGYHWRKYGEKQVKGSPYPRSYYKCSQQNCQVKKIVERNPENGEVSKSASKGVHNHA 59 8********************************************************7 PP
2	WRKY	99.9	1.5e-31	111	169	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDgy+WrKYGqK vkg+++prsYY+Ct agC+v+k+v rsa++ v+++ Yeg+Hnh+ gw1.1.725.1 111 MDDGYRWRKYGQKIVKGNPHPRSYYKCTVAGCTVRKHVGRSATEAGVLVTSYEGQHNHP 169 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00774	6.0E-26	1	60	IPR003657	WRKY domain
PROSITE profile	PS50811	25.281	1	61	IPR003657	WRKY domain
SuperFamily	SSF118290	8.37E-23	2	61	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	2.1E-23	2	61	IPR003657	WRKY domain
Pfam	PF03106	5.4E-21	2	58	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	9.1E-32	97	171	IPR003657	WRKY domain
SuperFamily	SSF118290	2.48E-27	105	171	IPR003657	WRKY domain
PROSITE profile	PS50811	32.627	106	171	IPR003657	WRKY domain
SMART	SM00774	3.5E-34	111	170	IPR003657	WRKY domain
Pfam	PF03106	3.2E-25	112	169	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0031347	Biological Process	regulation of defense response
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 171 aa Download sequence Send to blast
NDDGYHWRKY GEKQVKGSPY PRSYYKCSQQ NCQVKKIVER NPENGEVSKS ASKGVHNHAK 60 PGGSQGVGTS GRGGRFQGRG RAAQTSSLMR VQVQRSDNKH VVESRTDQDS MDDGYRWRKY 120 GQKIVKGNPH PRSYYKCTVA GCTVRKHVGR SATEAGVLVT SYEGQHNHPQ P

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	1e-29	2	171	8	78	Probable WRKY transcription factor 4
2lex_A	1e-29	2	171	8	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_005651953.1	1e-124	WRKY-domain-containing protein, partial
Swissprot	Q93WU7	2e-50	WRK58_ARATH; Probable WRKY transcription factor 58
TrEMBL	I0Z9U0	1e-122	I0Z9U0_COCSC; WRKY-domain-containing protein (Fragment)
STRING	XP_005651953.1	1e-123	(Coccomyxa subellipsoidea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP469	16	26

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G07100.2	1e-50	WRKY DNA-binding protein 26

Link Out ? help Back to Top
Entrez Gene	17045424

Publications ? help Back to Top
Blanc G, et al. The genome of the polar eukaryotic microalga Coccomyxa subellipsoidea reveals traits of cold adaptation. Genome Biol., 2012. 13(5): p. R39 [PMID:22630137] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]