 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
evm_27.model.AmTr_v1.0_scaffold00176.7 |
| Common Name | AMTR_s00176p00025440 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
| Family |
HSF |
| Protein Properties |
Length: 79aa MW: 8973.27 Da PI: 5.5712 |
| Description |
HSF family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| evm_27.model.AmTr_v1.0_scaffold00176.7 | genome | TAGP | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | HSF_DNA-bind | 81 | 1.8e-25 | 12 | 70 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y++++++++++++sws +g+sfv++d+ f++++Lpk+Fkh+nfaSFvRQLn+Y
evm_27.model.AmTr_v1.0_scaffold00176.7 12 FLTKTYDMVDEPTTNSMVSWSPSGTSFVIWDPPAFSQNLLPKHFKHRNFASFVRQLNTY 70
9*********************************************************9 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 2ldu_A | 1e-19 | 9 | 70 | 17 | 78 | Heat shock factor protein 1 |
| 5d5u_B | 1e-19 | 9 | 70 | 26 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 1e-19 | 9 | 70 | 26 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 1e-19 | 9 | 70 | 26 | 87 | Heat shock factor protein 1 |
| 5hdg_A | 8e-20 | 9 | 70 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_A | 8e-20 | 9 | 70 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_B | 8e-20 | 9 | 70 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_C | 8e-20 | 9 | 70 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_D | 8e-20 | 9 | 70 | 7 | 68 | Heat shock factor protein 1 |
| Search in ModeBase |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:7948881}. |
| Orthologous Group
? help Back to Top |
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP96 | 17 | 233 |
| Publications
? help Back to Top |
- Hsu SF,Jinn TL
AtHSBP functions in seed development and the motif is required for subcellular localization and interaction with AtHSFs.
Plant Signal Behav, 2010. 5(8): p. 1042-4
[PMID:20657173] - Liu HC,Charng YY
Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development.
Plant Physiol., 2013. 163(1): p. 276-90
[PMID:23832625] - Amborella Genome Project
The Amborella genome and the evolution of flowering plants.
Science, 2013. 342(6165): p. 1241089
[PMID:24357323] - Li S, et al.
HEAT-INDUCED TAS1 TARGET1 Mediates Thermotolerance via HEAT STRESS TRANSCRIPTION FACTOR A1a-Directed Pathways in Arabidopsis.
Plant Cell, 2014. 26(4): p. 1764-1780
[PMID:24728648] - Muench M,Hsin CH,Ferber E,Berger S,Mueller MJ
Reactive electrophilic oxylipins trigger a heat stress-like response through HSFA1 transcription factors.
J. Exp. Bot., 2016. 67(21): p. 6139-6148
[PMID:27811081]
|
