PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella

Family

MYB

Protein Properties

Length: 214aa MW: 25153.3 Da PI: 5.5609

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00145.39	genome	TAGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.7	1.1e-17	8	55	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed++lv++v ++G ++W+ Ia+ g++R++k+c++rw +yl evm_27.model.AmTr_v1.0_scaffold00145.39 8 KGPWTEQEDLQLVCYVGLFGERRWDFIAKVSGLNRSGKSCRLRWVNYL 55 79********************************************97 PP
2	Myb_DNA-binding	49.3	1.2e-15	61	106	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ T++E+ l++d+ ++G++ W++Iar+++ gRt++++k++w++++ evm_27.model.AmTr_v1.0_scaffold00145.39 61 RGKITPQEECLILDLQSRWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 106 8999****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.781	1	55	IPR017930	Myb domain
SuperFamily	SSF46689	7.11E-29	6	102	IPR009057	Homeodomain-like
SMART	SM00717	7.3E-16	7	57	IPR001005	SANT/Myb domain
Pfam	PF00249	1.7E-16	8	55	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.5E-21	9	62	IPR009057	Homeodomain-like
CDD	cd00167	1.15E-9	10	55	No hit	No description
PROSITE profile	PS51294	24.673	56	110	IPR017930	Myb domain
SMART	SM00717	5.6E-15	60	108	IPR001005	SANT/Myb domain
Pfam	PF00249	2.6E-13	61	105	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.2E-23	63	109	IPR009057	Homeodomain-like
CDD	cd00167	6.04E-9	65	106	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009723	Biological Process	response to ethylene
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010200	Biological Process	response to chitin
GO:0046686	Biological Process	response to cadmium ion
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 214 aa Download sequence Send to blast
MACIEIRKGP WTEQEDLQLV CYVGLFGERR WDFIAKVSGL NRSGKSCRLR WVNYLRPDLK 60 RGKITPQEEC LILDLQSRWG NRWSRIARKL PGRTDNEIKN YWRTHMRKKA QERRNDPSPQ 120 SCSSCLTSDK EREGRMLEKE GTKLNKEEGG EEGKSLMEEI WKEIEDYEGE FKFSSSSSME 180 SPLWEYSWDS LWKMETGEEE SLAPMCDPHD RES*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	1e-26	5	110	1	105	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	2e-26	5	110	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00600	PBM	Transfer from AT5G59780	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006844290.1	1e-154	transcription factor MYB59
Swissprot	Q4JL84	1e-69	MYB59_ARATH; Transcription factor MYB59
TrEMBL	W1PFW4	1e-153	W1PFW4_AMBTC; Uncharacterized protein
STRING	ERN05965	1e-154	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G59780.3	1e-66	myb domain protein 59

Link Out ? help Back to Top
Phytozome	evm_27.model.AmTr_v1.0_scaffold00145.39
Entrez Gene	18434151

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Amborella Genome Project The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376]