 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
evm_27.model.AmTr_v1.0_scaffold00071.216 |
Common Name | AMTR_s00071p00198970 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
Family |
M-type_MADS |
Protein Properties |
Length: 115aa MW: 12615.6 Da PI: 10.4721 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
evm_27.model.AmTr_v1.0_scaffold00071.216 | genome | TAGP | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 81.3 | 6.2e-26 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien rqvtf+kRr+g+lKKA ELS+LCda++ viifs++gkly+ s
evm_27.model.AmTr_v1.0_scaffold00071.216 9 KRIENPVHRQVTFCKRRAGLLKKARELSTLCDADIGVIIFSTHGKLYDLS 58
79*********************************************865 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem |
GO:0048364 | Biological Process | root development |
GO:0005634 | Cellular Component | nucleus |
GO:0003677 | Molecular Function | DNA binding |
GO:0046983 | Molecular Function | protein dimerization activity |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor. |
UniProt | Probable transcription factor. |
Orthologous Group
? help Back to Top |
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16 | 17 | 761 |
Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Lee S, et al.
Further characterization of a rice AGL12 group MADS-box gene, OsMADS26. Plant Physiol., 2008. 147(1): p. 156-68 [PMID:18354041] - Amborella Genome Project
The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323] - Khong GN, et al.
OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice. Plant Physiol., 2015. 169(4): p. 2935-49 [PMID:26424158]
|