PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella

Family

MYB_related

Protein Properties

Length: 89aa MW: 10342.9 Da PI: 10.3427

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00048.187	genome	TAGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.5	1.5e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT++Ede+l ++ k +G + W++ +++ g++R++k+c++rw++yl evm_27.model.AmTr_v1.0_scaffold00048.187 14 RGAWTADEDERLREYLKVHGEKKWRSLPARAGLNRCGKSCRLRWLNYL 61 89*********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	24.263	9	65	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.0E-22	9	64	IPR009057	Homeodomain-like
SMART	SM00717	1.2E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-16	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	9.58E-23	15	88	IPR009057	Homeodomain-like
CDD	cd00167	1.03E-9	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.4E-9	65	88	IPR009057	Homeodomain-like
PROSITE profile	PS51294	8.521	66	88	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MVKAKCYTGG KINRGAWTAD EDERLREYLK VHGEKKWRSL PARAGLNRCG KSCRLRWLNY 60 LRPDIKRGNF SEDEDDLIIR LHNLLGNR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	6e-17	11	88	24	100	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that regulates negatively genes involved in anthocyanin biosynthesis. {ECO:0000269\|PubMed:7920701}.
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020529088.1	3e-58	transcription factor MYB6
Swissprot	P20025	2e-37	MYB38_MAIZE; Myb-related protein Zm38
Swissprot	Q9SZP1	3e-37	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	U5D5P4	2e-57	U5D5P4_AMBTC; Uncharacterized protein
STRING	ERN15668	3e-58	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	1e-39	myb domain protein 4

Link Out ? help Back to Top
Phytozome	evm_27.model.AmTr_v1.0_scaffold00048.187

Publications ? help Back to Top
Amborella Genome Project The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701]