PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella

Family

NAC

Protein Properties

Length: 189aa MW: 21608.2 Da PI: 5.1041

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00044.29	genome	TAGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	104	1.9e-32	10	84	53	128
NAM 53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWv 122 +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v+ +++++g+kktLv+ykgrap+g++tdWv evm_27.model.AmTr_v1.0_scaffold00044.29 10 SRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVCM-QSRAIGMKKTLVYYKGRAPQGVRTDWV 78 4677************************************.999******************** PP NAM 123 mheyrl 128 mheyrl evm_27.model.AmTr_v1.0_scaffold00044.29 79 MHEYRL 84 **98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	39.744	1	107	IPR003441	NAC domain
SuperFamily	SSF101941	7.32E-39	10	108	IPR003441	NAC domain
Pfam	PF02365	1.7E-16	12	84	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 189 aa Download sequence Send to blast
MSTEKSFLPS RDPEWYFFGP RDRKYPNGFR TNRATRAGYW KSTGKDRRVC MQSRAIGMKK 60 TLVYYKGRAP QGVRTDWVMH EYRLDDKECE DTSGIQDTYA LCRVFKKNVA CPDTEDQGQF 120 TMPLPESLQI SASEYDTVSP EMLHGSSSST CMDVDDKDDA WMQFLMEDAW CSTRANDVES 180 SSCMALTN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-33	14	108	72	166	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-33	14	108	72	166	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-33	14	108	72	166	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-33	14	108	72	166	NO APICAL MERISTEM PROTEIN
3swm_A	5e-33	14	108	75	169	NAC domain-containing protein 19
3swm_B	5e-33	14	108	75	169	NAC domain-containing protein 19
3swm_C	5e-33	14	108	75	169	NAC domain-containing protein 19
3swm_D	5e-33	14	108	75	169	NAC domain-containing protein 19
3swp_A	5e-33	14	108	75	169	NAC domain-containing protein 19
3swp_B	5e-33	14	108	75	169	NAC domain-containing protein 19
3swp_C	5e-33	14	108	75	169	NAC domain-containing protein 19
3swp_D	5e-33	14	108	75	169	NAC domain-containing protein 19
4dul_A	4e-33	14	108	72	166	NAC domain-containing protein 19
4dul_B	4e-33	14	108	72	166	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269\|PubMed:25081480}.
UniProt	Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269\|PubMed:25081480}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269\|PubMed:25081480}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020530051.1	1e-137	NAC domain-containing protein 86
Swissprot	A4VCM0	7e-53	NAC45_ARATH; NAC domain-containing protein 45
Swissprot	Q9FFI5	7e-53	NAC86_ARATH; NAC domain-containing protein 86
TrEMBL	U5D4D5	1e-139	U5D4D5_AMBTC; Uncharacterized protein
STRING	ERN17060	1e-140	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP17	15	800

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G17730.1	3e-83	NAC domain containing protein 57

Link Out ? help Back to Top
Phytozome	evm_27.model.AmTr_v1.0_scaffold00044.29

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Amborella Genome Project The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323]