PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00042.29 | ||||||||
Common Name | AMTR_s00042p00120080, LOC18431723 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 156aa MW: 17381.7 Da PI: 4.376 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 73.4 | 3.7e-23 | 11 | 93 | 3 | 85 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatl 74 ++d lP a + +i+k++lP + ++++da++++ ec +efi +++se+++ c +e+++ti+++ +l al l evm_27.model.AmTr_v1.0_scaffold00042.29 11 KEDVSLPKATMFKIIKEMLPPDVRVARDAQDLLVECCVEFINLISSESNEVCGKEEKRTIAPEHVLRALEVL 82 68999******************************************************************* PP NF-YB 75 Gfedyveplkv 85 Gf dy+e++ + evm_27.model.AmTr_v1.0_scaffold00042.29 83 GFGDYIEEVYA 93 *******9865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.4E-39 | 8 | 140 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 7.14E-36 | 12 | 141 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.1E-20 | 15 | 79 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MEPMDIVGKS KEDVSLPKAT MFKIIKEMLP PDVRVARDAQ DLLVECCVEF INLISSESNE 60 VCGKEEKRTI APEHVLRALE VLGFGDYIEE VYAAYEQHKL ETLDSPKAGK WSSGAEMTEE 120 EALAEQQRMF AEARARMNNG VSIPKQSDSD RSLES* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 3e-37 | 12 | 134 | 12 | 133 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006841904.1 | 1e-111 | protein Dr1 homolog | ||||
Refseq | XP_011622414.1 | 1e-111 | protein Dr1 homolog | ||||
Refseq | XP_020521360.1 | 1e-111 | protein Dr1 homolog | ||||
Swissprot | P49592 | 2e-87 | NC2B_ARATH; Protein Dr1 homolog | ||||
TrEMBL | W1P7C1 | 1e-110 | W1P7C1_AMBTC; Uncharacterized protein | ||||
STRING | ERN03579 | 1e-111 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP3449 | 17 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23090.4 | 2e-91 | nuclear factor Y, subunit B13 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00042.29 |
Entrez Gene | 18431723 |
Publications ? help Back to Top | |||
---|---|---|---|
|