PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella

Family

MYB

Protein Properties

Length: 236aa MW: 26991.1 Da PI: 10.1091

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00019.457	genome	TAGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42.7	1.3e-13	45	91	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++e d+ ++++v q+G ++W+tIa+ + g +kqc++rw+++l evm_27.model.AmTr_v1.0_scaffold00019.457 45 KGQWSKEGDDMIIELVLQHGAKNWSTIAQALL-GWNGKQCRERWHNHL 91 799**************************9.***********97 PP
2	Myb_DNA-binding	46.6	8e-15	97	140	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 + +WT+ E++ l++a++q+G++ W + a+ ++ gRt + +k+ w++ evm_27.model.AmTr_v1.0_scaffold00019.457 97 KEAWTPHEELALIRAHQQHGNK-WVKLAKFLP-GRTNNAIKNNWNS 140 579*****************.*****.*******9985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.2E-9	23	51	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.041	40	95	IPR017930	Myb domain
SuperFamily	SSF46689	5.77E-28	42	138	IPR009057	Homeodomain-like
SMART	SM00717	1.3E-11	44	93	IPR001005	SANT/Myb domain
CDD	cd00167	7.63E-11	48	91	No hit	No description
Pfam	PF13921	1.1E-12	48	105	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.9E-21	52	98	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.068	96	146	IPR017930	Myb domain
SMART	SM00717	3.5E-12	96	144	IPR001005	SANT/Myb domain
CDD	cd00167	2.26E-9	99	142	No hit	No description
Gene3D	G3DSA:1.10.10.60	6.2E-22	99	146	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 236 aa Download sequence Send to blast
MAIITRQLLS IPLYAAMQHD TFFTYRTEVQ CYHRWHKVLN PDLVKGQWSK EGDDMIIELV 60 LQHGAKNWST IAQALLGWNG KQCRERWHNH LNPAIHKEAW TPHEELALIR AHQQHGNKWV 120 KLAKFLPGRT NNAIKNNWNS SLKKKLASYA GSGLLGQFPG YLLWTQLSHV SHLSLLHGIN 180 QPWGMTVSRM ELEWIICQNV VKNQFQLGAS NLNIVADTSV PAIHDASELK LTRRM*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h88_C	7e-49	22	146	35	159	MYB PROTO-ONCOGENE PROTEIN
1h89_C	7e-49	22	146	35	159	MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669, PubMed:25806785). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269\|PubMed:17287251, ECO:0000269\|PubMed:21862669, ECO:0000269\|PubMed:25806785}.; FUNCTION: Involved in transcription regulation during induced endoreduplication at the powdery mildew (e.g. G.orontii) infection site, thus promoting G.orontii growth and reproduction. {ECO:0000269\|PubMed:20018666}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by salicylic acid (SA) (PubMed:16463103). Expressed in a cell cycle-dependent manner, with highest levels 2 hours before the peak of mitotic index in cells synchronized by aphidicolin. Activated by CYCB1 (PubMed:17287251). Accumulates at powdery mildew (e.g. G.orontii) infected cells. {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:17287251}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020523603.1	1e-105	transcription factor MYB115 isoform X1
Swissprot	Q94FL9	4e-61	MB3R4_ARATH; Transcription factor MYB3R-4
TrEMBL	W1PID6	1e-174	W1PID6_AMBTC; Uncharacterized protein
STRING	ERN07489	1e-175	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G11510.2	2e-55	myb domain protein 3r-4

Link Out ? help Back to Top
Phytozome	evm_27.model.AmTr_v1.0_scaffold00019.457

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Amborella Genome Project The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323] Saito T, et al. Genetic interaction between G2/M phase-specific transcription factor MYB3R4 and MAPKKK ANP3 for execution of cytokinesis in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(3): p. e990817 [PMID:25806785] Kobayashi K, et al. Transcriptional repression by MYB3R proteins regulates plant organ growth. EMBO J., 2015. 34(15): p. 1992-2007 [PMID:26069325] Chen P, et al. Arabidopsis R1R2R3-Myb proteins are essential for inhibiting cell division in response to DNA damage. Nat Commun, 2017. 8(1): p. 635 [PMID:28935922]