PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00010.455
Common NameAMTR_s00010p00261620
Organism
Amborella trichopoda
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family ZF-HD
Protein Properties Length: 95aa    MW: 10456.6 Da    PI: 8.3354
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00010.455genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.41.3e-312680358
                               ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                                               vrY eC+kNhAa++Gg+a+DGC+Efm+s geegt++alkCaACgCHRnFH+re+e
  evm_27.model.AmTr_v1.0_scaffold00010.455 26 CVRYAECQKNHAANIGGYALDGCREFMAS-GEEGTSEALKCAACGCHRNFHKREEE 80
                                              689*************************9.999********************986 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-232791IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.4E-302779IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.3E-272878IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.2762978IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009741Biological Processresponse to brassinosteroid
GO:0043392Biological Processnegative regulation of DNA binding
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048509Biological Processregulation of meristem development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MRRQESSSRR NETHVRSSGQ CTRRKCVRYA ECQKNHAANI GGYALDGCRE FMASGEEGTS  60
EALKCAACGC HRNFHKREEE GVGICECPPS STTR*
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21455630}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020522610.18e-63mini zinc finger protein 1
SwissprotQ9CA511e-29MIF1_ARATH; Mini zinc finger protein 1
TrEMBLW1NGZ32e-61W1NGZ3_AMBTC; Uncharacterized protein
STRINGERM944793e-62(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.15e-32mini zinc finger 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]