PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella

Family

NF-YB

Protein Properties

Length: 179aa MW: 19441.7 Da PI: 8.196

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00010.298	genome	TAGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	171.6	8.7e-54	19	113	3	97
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwal 71 +q+r+lPianv+rimk+ lP+nakiskdaketvqec+sefisfvt+easdkc rekrktingddl+wa+ evm_27.model.AmTr_v1.0_scaffold00010.298 19 QQERLLPIANVGRIMKRSLPSNAKISKDAKETVQECASEFISFVTGEASDKCLREKRKTINGDDLIWAM 87 799**************************************************************** PP NF-YB 72 atlGfedyveplkvylkkyrelegek 97 +tlGfe+yv+plk+yl+kyr++ege+ evm_27.model.AmTr_v1.0_scaffold00010.298 88 TTLGFENYVAPLKAYLNKYRDIEGER 113 *********************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.0E-48	16	113	IPR009072	Histone-fold
SuperFamily	SSF47113	1.35E-37	20	118	IPR009072	Histone-fold
Pfam	PF00808	3.6E-26	23	87	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	4.4E-19	51	69	No hit	No description
PROSITE pattern	PS00685	0	54	70	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	4.4E-19	70	88	No hit	No description
PRINTS	PR00615	4.4E-19	89	107	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 179 aa Download sequence Send to blast
MTGRRSQLSP DADNPSRDQQ ERLLPIANVG RIMKRSLPSN AKISKDAKET VQECASEFIS 60 FVTGEASDKC LREKRKTING DDLIWAMTTL GFENYVAPLK AYLNKYRDIE GERVIKLSGG 120 TPSLVFDESS GDFQSRNGEV QGRTGSFQGG FGGGGVGGFM VERVGYGGDG HGQRVLQW*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-42	19	108	3	92	Transcription factor HapC (Eurofung)
4g92_B	2e-42	19	108	3	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006827085.1	1e-129	nuclear transcription factor Y subunit B-3
Swissprot	O23310	5e-56	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	W1NEW4	1e-128	W1NEW4_AMBTC; Uncharacterized protein
STRING	ERM94322	1e-128	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP168	17	170

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	2e-58	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	evm_27.model.AmTr_v1.0_scaffold00010.298
Entrez Gene	18422351

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Amborella Genome Project The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]