PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00009.376 | ||||||||
Common Name | AMTR_s00009p00264800, LOC18423134 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 189aa MW: 21744.9 Da PI: 9.2088 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 112.8 | 2.4e-35 | 20 | 110 | 2 | 101 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSB CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeek 70 Fl k+y++++d+e +++isw+++g+ fvv+ ++ef++++LpkyFkh nf+SF+RQLn+YgFkk +++ evm_27.model.AmTr_v1.0_scaffold00009.376 20 FLLKTYDLVNDPEARDIISWNHEGTGFVVWMPQEFSQSLLPKYFKHANFSSFIRQLNTYGFKKAASNR- 87 9**************************************************************99988. PP TTTTXTTSEEEEESXXXXXXXXXXXXXXXXX CS HSF_DNA-bind 71 kskskekiweFkhksFkkgkkellekikrkk 101 weFkh++F kg ++ll +i rkk evm_27.model.AmTr_v1.0_scaffold00009.376 88 --------WEFKHEKFVKGGRHLLMEISRKK 110 ........*********************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.9E-37 | 11 | 104 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 8.8E-31 | 15 | 109 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 1.2E-47 | 16 | 109 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 2.1E-31 | 20 | 109 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.4E-17 | 20 | 43 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.4E-17 | 58 | 70 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.4E-17 | 71 | 83 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MSHPDEPSPG SSKARSPAPF LLKTYDLVND PEARDIISWN HEGTGFVVWM PQEFSQSLLP 60 KYFKHANFSS FIRQLNTYGF KKAASNRWEF KHEKFVKGGR HLLMEISRKK GVPSVFPAFL 120 KACDNTRVLE QDLLEENKSL KIERASLQSE INYFKGLQRK LLCCISECVE RGRLGELDFE 180 LIRNSFQQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 6e-20 | 8 | 109 | 17 | 129 | Heat shock factor protein 1 |
5d5v_B | 6e-20 | 8 | 109 | 17 | 129 | Heat shock factor protein 1 |
5d5v_D | 6e-20 | 8 | 109 | 17 | 129 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006827773.1 | 1e-139 | heat stress transcription factor B-4d | ||||
Swissprot | P22335 | 6e-38 | HSF24_SOLPE; Heat shock factor protein HSF24 | ||||
Swissprot | Q6Z9C8 | 7e-38 | HFB2B_ORYSJ; Heat stress transcription factor B-2b | ||||
TrEMBL | W1NJ12 | 1e-137 | W1NJ12_AMBTC; Uncharacterized protein | ||||
STRING | ERM95189 | 1e-138 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP96 | 17 | 233 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G51910.1 | 5e-40 | heat shock transcription factor A7A |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00009.376 |
Entrez Gene | 18423134 |
Publications ? help Back to Top | |||
---|---|---|---|
|