PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm_27.model.AmTr_v1.0_scaffold00002.589

Common Name

AMTR_s00002p00270580

Organism

Amborella trichopoda

Taxonomic ID

13333

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella

Family

HSF

Protein Properties

Length: 336aa MW: 37643 Da PI: 5.4451

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00002.589	genome	TAGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	112	4.1e-35	67	160	1	103
HHHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SS CS HSF_DNA-bind 1 aFlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdee 69 aFl+k+ye+++d+++++++sw n n+fvv+d++ fa+ +Lp+yFkhsnf+SFvRQLn+Y F+kv+ ++ evm_27.model.AmTr_v1.0_scaffold00002.589 67 AFLTKTYEMVDDPSTDTVVSWGPNRNTFVVWDPNVFASLLLPNYFKHSNFSSFVRQLNTYSFRKVDPDR 135 69**************************************************************999 PP BTTTTXTTSEEEEESXXXXXXXXXXXXXXXXXXX CS HSF_DNA-bind 70 kkskskekiweFkhksFkkgkkellekikrkkse 103 weF++k F kgkk+ll+ ikr+k + evm_27.model.AmTr_v1.0_scaffold00002.589 136 ---------WEFANKAFLKGKKHLLRAIKRRKPS 160 .........********************975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46785	4.62E-34	64	157	IPR011991	Winged helix-turn-helix DNA-binding domain
Gene3D	G3DSA:1.10.10.10	3.9E-37	64	157	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	2.5E-54	64	157	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.5E-19	68	91	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	5.9E-31	68	157	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.5E-19	106	118	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PROSITE pattern	PS00434	0	107	131	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.5E-19	119	131	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 336 aa Download sequence Send to blast
MENQQGSVKE EREENEEIDF GEEWGGGSSS SCWYYCAGEE GAPMGAGGSE PIVPRPMEGL 60 NEVGPPAFLT KTYEMVDDPS TDTVVSWGPN RNTFVVWDPN VFASLLLPNY FKHSNFSSFV 120 RQLNTYSFRK VDPDRWEFAN KAFLKGKKHL LRAIKRRKPS HPYHQTSAPS NLQVGATGLD 180 TELERLRQGK ELLTIELVHL RQQQHASLVR LNGLSQRLEH TEHRHRQMTD FLARAMRHPT 240 FMQNLASPAQ PQRTVLPAED TTKKRKELEG SSSGSGSGSR IEPLLRPCGF DDDDDPSFLA 300 ELFGERFEPV SEPTCDPDVD TLAEKLGFLG SGHEP*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	2e-24	66	157	27	129	Heat shock factor protein 1
5d5v_B	2e-24	66	157	27	129	Heat shock factor protein 1
5d5v_D	2e-24	66	157	27	129	Heat shock factor protein 1
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	151	156	RAIKRR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress responses. Seems to be involved in other environmental stress responses. Activates ascorbate peroxidase 2 (APX2) in addition to several heat shock protein (HSPs). {ECO:0000269\|PubMed:16649111, ECO:0000269\|PubMed:17059409, ECO:0000269\|PubMed:17085506}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress, high light and hydrogen peroxide (H(2)O(2)). {ECO:0000269\|PubMed:16649111, ECO:0000269\|PubMed:17059409, ECO:0000269\|PubMed:17085506}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020520164.1	0.0	heat stress transcription factor A-2b
Swissprot	O80982	2e-80	HSFA2_ARATH; Heat stress transcription factor A-2
TrEMBL	W1P0P7	0.0	W1P0P7_AMBTC; Uncharacterized protein
STRING	ERN01513	0.0	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP96	17	233

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G26150.1	1e-82	heat shock transcription factor A2

Link Out ? help Back to Top
Phytozome	evm_27.model.AmTr_v1.0_scaffold00002.589

Publications ? help Back to Top
Liu HC,Charng YY Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development. Plant Physiol., 2013. 163(1): p. 276-90 [PMID:23832625] Jung HS, et al. Subset of heat-shock transcription factors required for the early response of Arabidopsis to excess light. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(35): p. 14474-9 [PMID:23918368] Chauhan H,Khurana N,Agarwal P,Khurana JP,Khurana P A seed preferential heat shock transcription factor from wheat provides abiotic stress tolerance and yield enhancement in transgenic Arabidopsis under heat stress environment. PLoS ONE, 2013. 8(11): p. e79577 [PMID:24265778] Amborella Genome Project The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Weng M, et al. Histone chaperone ASF1 is involved in gene transcription activation in response to heat stress in Arabidopsis thaliana. Plant Cell Environ., 2014. 37(9): p. 2128-38 [PMID:24548003] Jang YH, et al. A homolog of splicing factor SF1 is essential for development and is involved in the alternative splicing of pre-mRNA in Arabidopsis thaliana. Plant J., 2014. 78(4): p. 591-603 [PMID:24580679] Stief A, et al. Arabidopsis miR156 Regulates Tolerance to Recurring Environmental Stress through SPL Transcription Factors. Plant Cell, 2014. 26(4): p. 1792-1807 [PMID:24769482] Dobrá J, et al. The impact of heat stress targeting on the hormonal and transcriptomic response in Arabidopsis. Plant Sci., 2015. 231: p. 52-61 [PMID:25575991] Yamauchi Y,Kunishima M,Mizutani M,Sugimoto Y Reactive short-chain leaf volatiles act as powerful inducers of abiotic stress-related gene expression. Sci Rep, 2015. 5: p. 8030 [PMID:25619826] Shi H, et al. Melatonin induces class A1 heat-shock factors (HSFA1s) and their possible involvement of thermotolerance in Arabidopsis. J. Pineal Res., 2015. 58(3): p. 335-42 [PMID:25711624] Mueller SP,Krause DM,Mueller MJ,Fekete A Accumulation of extra-chloroplastic triacylglycerols in Arabidopsis seedlings during heat acclimation. J. Exp. Bot., 2015. 66(15): p. 4517-26 [PMID:25977236] Nie S,Yue H,Xing D A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance. Plant Physiol., 2016. [PMID:26099269] Nguyen AH, et al. Loss of Arabidopsis 5'-3' Exoribonuclease AtXRN4 Function Enhances Heat Stress Tolerance of Plants Subjected to Severe Heat Stress. Plant Cell Physiol., 2015. 56(9): p. 1762-72 [PMID:26136597] Hu Z, et al. Histone acetyltransferase GCN5 is essential for heat stress-responsive gene activation and thermotolerance in Arabidopsis. Plant J., 2015. 84(6): p. 1178-91 [PMID:26576681] Lämke J,Brzezinka K,Bäurle I HSFA2 orchestrates transcriptional dynamics after heat stress in Arabidopsis thaliana. Transcription, 2016. 7(4): p. 111-4 [PMID:27383578] Wang X,Huang W,Liu J,Yang Z,Huang B Molecular regulation and physiological functions of a novel FaHsfA2c cloned from tall fescue conferring plant tolerance to heat stress. Plant Biotechnol. J., 2017. 15(2): p. 237-248 [PMID:27500592] Chen ST,He NY,Chen JH,Guo FQ Identification of core subunits of photosystem II as action sites of HSP21, which is activated by the GUN5-mediated retrograde pathway in Arabidopsis. Plant J., 2017. 89(6): p. 1106-1118 [PMID:27943531] Kataoka R,Takahashi M,Suzuki N Coordination between bZIP28 and HSFA2 in the regulation of heat response signals in Arabidopsis. Plant Signal Behav, 2017. 12(11): p. e1376159 [PMID:28873003] Wang X,Zhuang L,Shi Y,Huang B Up-Regulation of HSFA2c and HSPs by ABA Contributing to Improved Heat Tolerance in Tall Fescue and Arabidopsis. Int J Mol Sci, 2018. [PMID:28914758] Llamas E,Pulido P,Rodriguez-Concepcion M Interference with plastome gene expression and Clp protease activity in Arabidopsis triggers a chloroplast unfolded protein response to restore protein homeostasis. PLoS Genet., 2017. 13(9): p. e1007022 [PMID:28937985] Li X, et al. Plastid Translation Elongation Factor Tu Is Prone to Heat-Induced Aggregation Despite Its Critical Role in Plant Heat Tolerance. Plant Physiol., 2018. 176(4): p. 3027-3045 [PMID:29444814]