PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_9.193 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 161aa MW: 18532.6 Da PI: 6.6013 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 165.5 | 7.1e-52 | 34 | 129 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyvepl 83 +eqdr+lPianv+rimk++lP +akisk+aket+qecvsefisfvt+eas +c+rekrkt+ngdd++wala+lGf++y+e+l evm.model.supercontig_9.193 34 KEQDRLLPIANVGRIMKQILPPKAKISKEAKETMQECVSEFISFVTGEASVRCNREKRKTVNGDDVCWALASLGFDNYAEQL 115 89******************************************************************************** PP NF-YB 84 kvylkkyrelegek 97 + yl++yre+ege+ evm.model.supercontig_9.193 116 RRYLQRYRETEGER 129 ***********997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.0E-51 | 28 | 137 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 8.07E-38 | 36 | 136 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.7E-26 | 39 | 103 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.4E-18 | 67 | 85 | No hit | No description |
PRINTS | PR00615 | 2.4E-18 | 86 | 104 | No hit | No description |
PRINTS | PR00615 | 2.4E-18 | 105 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MGDRDSAYKY ILDREGDHHH HHQDHHYQDH EVIKEQDRLL PIANVGRIMK QILPPKAKIS 60 KEAKETMQEC VSEFISFVTG EASVRCNREK RKTVNGDDVC WALASLGFDN YAEQLRRYLQ 120 RYRETEGERS SSSHNQTVGA SDSVNDRRKM INLFGIDGED * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-43 | 33 | 124 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-43 | 33 | 124 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_9.193 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021906789.1 | 1e-118 | nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O82248 | 2e-55 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | W9QWP6 | 4e-61 | W9QWP6_9ROSA; Nuclear transcription factor Y subunit B-5 | ||||
STRING | evm.model.supercontig_9.193 | 1e-118 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-57 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_9.193 |
Publications ? help Back to Top | |||
---|---|---|---|
|