![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_77.16 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 66aa MW: 7426.69 Da PI: 7.7384 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 58.2 | 3.7e-18 | 7 | 63 | 5 | 61 |
YABBY 5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes 61 + e++Cy+ C++C+ ++av vP +sl+ +vt+rC hC++l svn+a + q +++++ evm.model.supercontig_77.16 7 FECERLCYMPCKHCKIVVAVRVPCSSLYDIVTIRCVHCSNLWSVNMAATLQSMSTQD 63 5689*******************************************9999988876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.5E-18 | 9 | 62 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 66 aa Download sequence Send to blast |
MSSSNGFECE RLCYMPCKHC KIVVAVRVPC SSLYDIVTIR CVHCSNLWSV NMAATLQSMS 60 TQDLHQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_77.16 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021895056.1 | 1e-42 | axial regulator YABBY 5-like isoform X1 | ||||
Swissprot | Q8GW46 | 1e-22 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
TrEMBL | A0A2G5DFY8 | 3e-22 | A0A2G5DFY8_AQUCA; Uncharacterized protein | ||||
STRING | evm.model.supercontig_77.16 | 3e-42 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5538 | 26 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 5e-25 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_77.16 |
Publications ? help Back to Top | |||
---|---|---|---|
|