![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_77.14 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 49aa MW: 5489.34 Da PI: 5.5869 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 27 | 1.4e-08 | 12 | 45 | 30 | 63 |
YABBY 30 slfkvvtvrCGhCtsllsvnlakasqllaaeshl 63 lf+++tvrCGhCt++ v++ a q +++++ evm.model.supercontig_77.14 12 NLFEIMTVRCGHCTNVCYVDMGAAFQYSMSSKDV 45 589******************9988776666654 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 2.1E-7 | 12 | 45 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 49 aa Download sequence Send to blast |
MQYNTELFTA INLFEIMTVR CGHCTNVCYV DMGAAFQYSM SSKDVQVK* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_77.14 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021895008.1 | 9e-19 | axial regulator YABBY 5-like isoform X2 | ||||
STRING | evm.model.supercontig_77.14 | 9e-29 | (Carica papaya) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 4e-08 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_77.14 |