PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica

Family

HSF

Protein Properties

Length: 157aa MW: 18057.7 Da PI: 7.446

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm.model.supercontig_49.32	genome	ASGPB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	82.9	4.8e-26	26	86	2	62
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62 Fl+k+y++++d+++++++sw e+ ++fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y + evm.model.supercontig_49.32 26 FLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYVY 86 9**********************************************************76 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	4.0E-28	18	86	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	1.3E-27	22	127	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	8.16E-25	25	99	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	2.9E-16	26	49	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	6.3E-22	26	86	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.9E-16	64	76	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.9E-16	77	89	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 157 aa Download sequence Send to blast
MAALMLDNCE GILLSLDSHK SVPAPFLTKT YQLVDDPSTD HIVSWGEDDT TFVVWRPPEF 60 ARDLLPNYFK HNNFSSFVRQ LNTYVYYIYP PTYISSMLYI NSMALLIWVL CFWVVDGTRV 120 LGRLYLTDGS LQTSSSRRER SICCVRSTEG KQHSRR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	3e-16	21	86	25	89	Heat shock factor protein 1
5d5v_B	3e-16	21	86	25	89	Heat shock factor protein 1
5d5v_D	3e-16	21	86	25	89	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269\|PubMed:16202242}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	evm.model.supercontig_49.32

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021898582.1	6e-55	heat stress transcription factor B-4
Swissprot	Q7XHZ0	2e-40	HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBL	A0A068U135	9e-53	A0A068U135_COFCA; Uncharacterized protein
TrEMBL	A0A2G2VBY3	3e-52	A0A2G2VBY3_CAPBA; Heat stress transcription factor B-4
TrEMBL	A0A2G2Y0E5	3e-52	A0A2G2Y0E5_CAPAN; Heat stress transcription factor B-4
TrEMBL	A0A2G3CQ07	3e-52	A0A2G3CQ07_CAPCH; Heat stress transcription factor B-4
STRING	evm.model.supercontig_49.32	1e-113	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2900	28	66
Representative plant	OGRP96	17	233

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G46264.1	2e-40	heat shock transcription factor B4

Link Out ? help Back to Top
Phytozome	evm.model.supercontig_49.32

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]