PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica

Family

MYB

Protein Properties

Length: 125aa MW: 14767.7 Da PI: 9.8281

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm.model.supercontig_34.62	genome	ASGPB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.8	9.1e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd +l+ +v+++G +W+ +r g+ R++k+c++rw +yl evm.model.supercontig_34.62 14 KGTWTPEEDRKLIAYVTRYGCWNWRQLPRFAGLARCGKSCRLRWMNYL 61 799***************99**********************97 PP
2	Myb_DNA-binding	50.6	4.3e-16	67	109	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg+ T+eE++ ++++++ lG++ W++Ia+++ gRt++++k++w evm.model.supercontig_34.62 67 RGNYTKEEEDTILRLHETLGNK-WSAIAAHLA-GRTDNEIKNHWA 109 899*****************.*****.*********6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.69	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	2.91E-30	11	108	IPR009057	Homeodomain-like
SMART	SM00717	4.8E-10	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.7E-14	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.7E-24	15	68	IPR009057	Homeodomain-like
CDD	cd00167	1.25E-8	16	61	No hit	No description
SMART	SM00717	1.2E-13	66	114	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	14.581	66	116	IPR017930	Myb domain
Pfam	PF00249	6.3E-15	67	108	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.6E-24	69	111	IPR009057	Homeodomain-like
CDD	cd00167	1.64E-9	69	108	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 125 aa Download sequence Send to blast
MVRTPSFDEN GLKKGTWTPE EDRKLIAYVT RYGCWNWRQL PRFAGLARCG KSCRLRWMNY 60 LRPNIKRGNY TKEEEDTILR LHETLGNKWS AIAAHLAGRT DNEIKNHWAH HPQETQFENE 120 RNQL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	4e-26	12	108	5	100	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269\|PubMed:14675437, ECO:0000269\|PubMed:20807373, ECO:0000269\|PubMed:22246661}.
UniProt	Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269\|PubMed:24902892}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	evm.model.supercontig_34.62

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cold stress. {ECO:0000269\|PubMed:14675437, ECO:0000269\|PubMed:20807373, ECO:0000269\|Ref.2}.
UniProt	INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269\|PubMed:24902892}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021901070.1	1e-89	transcription factor MYB4-like
Swissprot	Q7XBH4	7e-52	MYB4_ORYSJ; Transcription factor MYB4
Swissprot	Q9S9Z2	3e-51	MYB93_ARATH; Transcription factor MYB93
TrEMBL	A0A1R3JCN6	1e-67	A0A1R3JCN6_COCAP; Uncharacterized protein
STRING	evm.model.supercontig_34.62	4e-89	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G34670.1	1e-53	myb domain protein 93

Link Out ? help Back to Top
Phytozome	evm.model.supercontig_34.62

Publications ? help Back to Top
Park MR, et al. Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development. Plant Cell Environ., 2010. 33(12): p. 2209-30 [PMID:20807373] Soltész A, et al. The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants. J. Appl. Genet., 2012. 53(2): p. 133-43 [PMID:22246661] Gibbs DJ,Coates JC AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis. Plant Signal Behav, 2014. 9(10): p. e970406 [PMID:25482809]