PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_27.40 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 146aa MW: 16451.1 Da PI: 6.9849 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 128.1 | 3.4e-40 | 60 | 137 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +Cq+++C++d+ +ak+y++rhkvCe h+ka+ vlv+g++qrfCqqCsrfhe+sefD++krsCrrrLa+hnerrrk+++ evm.model.supercontig_27.40 60 CCQADHCTVDMGDAKRYYKRHKVCEYHAKASFVLVNGVQQRFCQQCSRFHEVSEFDDTKRSCRRRLAGHNERRRKSST 137 6**************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 1.9E-57 | 1 | 145 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 1.0E-31 | 55 | 122 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 30.94 | 58 | 135 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.67E-38 | 59 | 140 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 7.4E-32 | 61 | 134 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MGTSRAEGKR SLKEIEEDEE EEEDDDCTGG LGFEEEEKKK KKGRRGSSAA EAAGASMLPC 60 CQADHCTVDM GDAKRYYKRH KVCEYHAKAS FVLVNGVQQR FCQQCSRFHE VSEFDDTKRS 120 CRRRLAGHNE RRRKSSTDYI GDGSN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-36 | 52 | 134 | 2 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_27.40 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021902083.1 | 1e-102 | squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q38741 | 3e-43 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A1R3H4E4 | 2e-57 | A0A1R3H4E4_9ROSI; Squamosa promoter-binding-like protein | ||||
STRING | evm.model.supercontig_27.40 | 1e-102 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM868 | 28 | 118 | Representative plant | OGRP97 | 17 | 230 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 9e-41 | squamosa promoter binding protein-like 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_27.40 |
Publications ? help Back to Top | |||
---|---|---|---|
|