PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_185.8 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 104aa MW: 11642.8 Da PI: 10.1298 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 46.2 | 5.9e-15 | 12 | 51 | 4 | 43 |
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43 n+s r+ t+ k ++g++KK +ELS+LCd+++ i++s+ evm.model.supercontig_185.8 12 TNDSARKATLKKKKKGLMKKVSELSTLCDVKAYAIMYSPY 51 799***********************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 9.4E-15 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 14.591 | 1 | 49 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-9 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.63E-21 | 4 | 95 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.4E-15 | 11 | 51 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-9 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-9 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MIGNKVELAY VTNDSARKAT LKKKKKGLMK KVSELSTLCD VKAYAIMYSP YDSKLEVCPS 60 PLEAQHVLAD FKRIPEIEQG KKMVNQESVL LQRITKATDQ LKK* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 21 | 30 | KKKKKGLMKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_185.8 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021911215.1 | 9e-58 | agamous-like MADS-box protein AGL80 | ||||
Swissprot | Q9FJK3 | 1e-26 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
TrEMBL | U5GF69 | 8e-42 | U5GF69_POPTR; Uncharacterized protein | ||||
STRING | evm.model.supercontig_185.8 | 2e-69 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM70 | 28 | 415 | Representative plant | OGRP114 | 13 | 173 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48670.1 | 1e-27 | AGAMOUS-like 80 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_185.8 |
Publications ? help Back to Top | |||
---|---|---|---|
|