![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_183.32 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 93aa MW: 10497.8 Da PI: 9.3639 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 30.5 | 6.7e-10 | 19 | 59 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 d+i + + +L++l+P++ + +s Kls + +L+++++YI++L evm.model.supercontig_183.32 19 DQITELITKLQQLIPELRHRRSDKLSASKVLQETCNYIRNL 59 6899************879********************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.280.10 | 1.2E-9 | 3 | 73 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
PROSITE profile | PS50888 | 11.033 | 5 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 5.89E-10 | 18 | 77 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 2.8E-7 | 19 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 93 aa Download sequence Send to blast |
MSSRRSRSRQ SSSSRISDDQ ITELITKLQQ LIPELRHRRS DKLSASKVLQ ETCNYIRNLH 60 REVDDLSDRL SALLASTDSD SPEAAIIRSL LM* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_183.32 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021887859.1 | 6e-57 | transcription factor PRE6-like | ||||
Swissprot | Q9LJX1 | 1e-38 | PRE5_ARATH; Transcription factor PRE5 | ||||
TrEMBL | A0A1U8FK00 | 2e-43 | A0A1U8FK00_CAPAN; Transcription factor PRE5 | ||||
TrEMBL | A0A2G2XD16 | 2e-43 | A0A2G2XD16_CAPBA; Transcription factor PRE5 | ||||
TrEMBL | A0A2G3A645 | 2e-43 | A0A2G3A645_CAPAN; transcription factor PRE6-like | ||||
STRING | evm.model.supercontig_183.32 | 2e-56 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM259 | 28 | 225 |
Representative plant | OGRP1877 | 12 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26945.1 | 7e-25 | bHLH family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_183.32 |