![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_142.59 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 140aa MW: 16319.6 Da PI: 10.8791 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 44.3 | 3.9e-14 | 53 | 99 | 5 | 51 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 ++ rr+++NRe+ArrsR RKk++ e L+ v L+ eN+aLk +l + evm.model.supercontig_142.59 53 RKRRRMISNRESARRSRWRKKQYEEILTAQVNRLTVENRALKHRLGS 99 5789**************************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.1E-13 | 49 | 113 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 5.2E-13 | 51 | 98 | No hit | No description |
PROSITE profile | PS50217 | 10.45 | 51 | 103 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.8E-12 | 53 | 99 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.63E-11 | 53 | 104 | No hit | No description |
CDD | cd14702 | 3.61E-14 | 54 | 103 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 56 | 71 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MFFPEEAVHF QLPVLSSNEI EELLALLQSD HDPVSVNSGS EGSSRTVHVL DERKRRRMIS 60 NRESARRSRW RKKQYEEILT AQVNRLTVEN RALKHRLGSV LNQWMLTWGE NERLKSEVVG 120 LRARLSDLHR VFLVMQSRN* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 52 | 56 | RKRRR |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_142.59 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021285085.1 | 3e-47 | basic leucine zipper 4 | ||||
TrEMBL | A0A2P5CWW1 | 6e-46 | A0A2P5CWW1_PARAD; Basic-leucine zipper transcription factor | ||||
STRING | evm.model.supercontig_142.59 | 1e-95 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM12232 | 24 | 32 | Representative plant | OGRP11732 | 4 | 6 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G59530.1 | 4e-23 | basic leucine-zipper 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_142.59 |