![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_114.51 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 134aa MW: 14114.9 Da PI: 5.7265 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 85.2 | 7.7e-27 | 31 | 79 | 1 | 49 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49 vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+ts+ evm.model.supercontig_114.51 31 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSD 79 69*********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 4.82E-17 | 18 | 79 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 4.7E-25 | 28 | 78 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.5E-16 | 37 | 78 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MAEQQAQGQG APASPGGGSH ESGDHSPRSN VREQDRYLPI ANISRIMKKA LPANGKIAKD 60 AKETVQECVS EFISFITSDF LYAPTIFIVV GAKLVGANFS LSIGGFSEDT LDSDKLSCKS 120 SVEFIGQSCK TLS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-21 | 31 | 79 | 1 | 49 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-21 | 31 | 79 | 1 | 49 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_114.51 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021891559.1 | 8e-51 | nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
Refseq | XP_021891561.1 | 8e-51 | nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
Swissprot | Q8VYK4 | 4e-32 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A067EJC8 | 4e-41 | A0A067EJC8_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A0R0KT72 | 7e-41 | A0A0R0KT72_SOYBN; Uncharacterized protein | ||||
TrEMBL | A0A445LE50 | 7e-41 | A0A445LE50_GLYSO; Nuclear transcription factor Y subunit B-8 isoform A | ||||
STRING | evm.model.supercontig_114.51 | 2e-93 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM26062 | 3 | 3 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 1e-29 | nuclear factor Y, subunit B10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_114.51 |
Publications ? help Back to Top | |||
---|---|---|---|
|