 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
evm.model.supercontig_111.24 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
Family |
MYB_related |
Protein Properties |
Length: 88aa MW: 10078.5 Da PI: 10.4861 |
Description |
MYB_related family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
evm.model.supercontig_111.24 | genome | ASGPB | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 58.5 | 1.5e-18 | 13 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WTteEd++l+d +k++G g W+t +++ g+ R++k+c++rw +yl
evm.model.supercontig_111.24 13 KGAWTTEEDKKLIDWIKEHGEGGWRTLPQRAGLQRCGKSCRLRWTNYL 60
79********************************************97 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Major regulator of short-chained aliphatic glucosinolates (GLSs) biosynthesis. Together with MYB29/HAG3 and MYB76/HAG2, promotes aliphatic glucosinolate biosynthesis but represses indolic glucosinolate biosynthesis. Prevents insect performance (e.g. lepidopteran insect Mamestra brassicae and Spodoptera exigua) by promoting glucosinolates. {ECO:0000269|PubMed:17420480, ECO:0000269|PubMed:17521412, ECO:0000269|PubMed:18042203, ECO:0000269|PubMed:18446225, ECO:0000269|PubMed:20348214, ECO:0000269|PubMed:23580754, ECO:0000269|PubMed:23792303, ECO:0000269|PubMed:23943862}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Slightly induced by glucose, gibberellic acid (GA), jasmonic acid (JA) and salicylic acid (SA). Transiently induced in inflorescence by mechanical stimuli such as touch or wounding, including herbivory-wounding. Up-regulated by sulfur-deficient stress. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17521412, ECO:0000269|PubMed:23115560, ECO:0000269|PubMed:23792303}. |
Orthologous Group
? help Back to Top |
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Representative plant | OGRP5 | 17 | 1784 |
Publications
? help Back to Top |
- Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Kim K,Jiang K,Teng SL,Feldman LJ,Huang H
Using biologically interrelated experiments to identify pathway genes in Arabidopsis. Bioinformatics, 2012. 28(6): p. 815-22 [PMID:22271267] - Augustine R,Majee M,Gershenzon J,Bisht NC
Four genes encoding MYB28, a major transcriptional regulator of the aliphatic glucosinolate pathway, are differentially expressed in the allopolyploid Brassica juncea. J. Exp. Bot., 2013. 64(16): p. 4907-21 [PMID:24043856] - Guo R, et al.
Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(18): p. 5707-19 [PMID:24151308] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Li F, et al.
Genome-wide association study dissects the genetic architecture of seed weight and seed quality in rapeseed (Brassica napus L.). DNA Res., 2014. 21(4): p. 355-67 [PMID:24510440] - Frerigmann H,Gigolashvili T
Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] - Burow M, et al.
The Glucosinolate Biosynthetic Gene AOP2 Mediates Feed-back Regulation of Jasmonic Acid Signaling in Arabidopsis. Mol Plant, 2015. 8(8): p. 1201-12 [PMID:25758208] - Martínez-Ballesta M, et al.
The impact of the absence of aliphatic glucosinolates on water transport under salt stress in Arabidopsis thaliana. Front Plant Sci, 2015. 6: p. 524 [PMID:26236322] - Seo MS, et al.
Functional analysis of three BrMYB28 transcription factors controlling the biosynthesis of glucosinolates in Brassica rapa. Plant Mol. Biol., 2016. 90(4-5): p. 503-16 [PMID:26820138] - Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] - Mostafa I, et al.
New nodes and edges in the glucosinolate molecular network revealed by proteomics and metabolomics of Arabidopsis myb28/29 and cyp79B2/B3 glucosinolate mutants. J Proteomics, 2016. 138: p. 1-19 [PMID:26915584] - Smith JD,Woldemariam MG,Mescher MC,Jander G,De Moraes CM
Glucosinolates from Host Plants Influence Growth of the Parasitic Plant Cuscuta gronovii and Its Susceptibility to Aphid Feeding. Plant Physiol., 2016. 172(1): p. 181-97 [PMID:27482077] - Aarabi F, et al.
Sulfur deficiency-induced repressor proteins optimize glucosinolate biosynthesis in plants. Sci Adv, 2016. 2(10): p. e1601087 [PMID:27730214] - Mostafa I, et al.
Membrane Proteomics of Arabidopsis Glucosinolate Mutants cyp79B2/B3 and myb28/29. Front Plant Sci, 2017. 8: p. 534 [PMID:28443122] - Simon MK,Skinner DJ,Gallagher TL,Gasser CS
Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors. Genetics, 2017. 207(4): p. 1489-1500 [PMID:28971961] - Li B, et al.
Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis. Plant Cell, 2018. 30(1): p. 178-195 [PMID:29317470]
|