![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_1.264 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 162aa MW: 17489.6 Da PI: 5.7211 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 177.9 | 9.1e-56 | 25 | 119 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyvep 82 vreqdr+lPian+srimkk+lP n+ki+kdak+tvqecvsefisf+tseasdkcq+ekrktingddllwa+atlGfedy+ep evm.model.supercontig_1.264 25 VREQDRYLPIANISRIMKKALPPNGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEP 106 69******************************************************************************** PP NF-YB 83 lkvylkkyreleg 95 lk+yl++yre ++ evm.model.supercontig_1.264 107 LKIYLARYREGDT 119 *********9665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.7E-53 | 20 | 120 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.55E-39 | 28 | 122 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.3E-28 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.8E-21 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.8E-21 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 2.8E-21 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MADAPTSPAG GSHESGGEQS PHSGVREQDR YLPIANISRI MKKALPPNGK IAKDAKDTVQ 60 ECVSEFISFI TSEASDKCQK EKRKTINGDD LLWAMATLGF EDYIEPLKIY LARYREGDTK 120 GSARGGDGSV KRDAVGGLPG QNAQFLHCLF FIDDALSSFS F* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 8e-48 | 25 | 116 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 8e-48 | 25 | 116 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_1.264 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021910503.1 | 1e-102 | nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | Q9SLG0 | 5e-76 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
TrEMBL | A0A0H3XV68 | 2e-96 | A0A0H3XV68_VERFO; Nuclear transcription factor Y subunit B-1 | ||||
TrEMBL | B9SD43 | 2e-96 | B9SD43_RICCO; Ccaat-binding transcription factor subunit A, putative | ||||
STRING | evm.model.supercontig_1.264 | 1e-117 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1480 | 27 | 94 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.7 | 2e-80 | nuclear factor Y, subunit B1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_1.264 |