![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | e_gw1.2.581.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 111aa MW: 12668.6 Da PI: 8.0568 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 180.4 | 1.6e-56 | 3 | 94 | 2 | 93 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 reqdrflPian+srimkk+lP+naki+kdaketvqecvsefisfvtseasdkcqrekrktingddllwa++tlGfe+yveplk++l+kyre+ e_gw1.2.581.1 3 REQDRFLPIANISRIMKKALPTNAKIAKDAKETVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMSTLGFEEYVEPLKLFLSKYREV 94 89****************************************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.6E-52 | 2 | 94 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.74E-39 | 5 | 94 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-28 | 8 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.2E-23 | 36 | 54 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 39 | 55 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.2E-23 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 7.2E-23 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MAREQDRFLP IANISRIMKK ALPTNAKIAK DAKETVQECV SEFISFVTSE ASDKCQREKR 60 KTINGDDLLW AMSTLGFEEY VEPLKLFLSK YREVSPILDH FHCANAKISW * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 7e-48 | 3 | 93 | 3 | 93 | NF-YB |
4awl_B | 6e-48 | 3 | 93 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 6e-48 | 3 | 93 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004305679.1 | 1e-59 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_024369282.1 | 1e-59 | nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
Swissprot | O23310 | 7e-59 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A2U1M8K8 | 3e-58 | A0A2U1M8K8_ARTAN; NF-Y protein | ||||
STRING | XP_004305679.1 | 5e-59 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP2023 | 16 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 3e-61 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|