![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_75236_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 104aa MW: 11843 Da PI: 9.5474 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 71.2 | 1.9e-22 | 1 | 73 | 14 | 86 |
trihelix 14 rremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 r+e+++ ++++k++k+lWe +s kmre+gf rsp++C++kw+nl k++kk k+++++++ ++s ++ y++++e cra_locus_75236_iso_1_len_310_ver_3 1 RKEIDSLFNTSKSNKHLWENISLKMREQGFDRSPTMCTDKWRNLLKEFKKAKTNNQDGNGNVSAKMGYYKEIE 73 688999*****************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd12203 | 1.16E-18 | 1 | 52 | No hit | No description |
Pfam | PF13837 | 6.1E-15 | 6 | 75 | No hit | No description |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
RKEIDSLFNT SKSNKHLWEN ISLKMREQGF DRSPTMCTDK WRNLLKEFKK AKTNNQDGNG 60 NVSAKMGYYK EIEEILKERS KDGPGGGGAD EGVSKVDSFM QFAX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2jmw_A | 1e-32 | 1 | 71 | 19 | 86 | DNA binding protein GT-1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals. {ECO:0000269|PubMed:10437822, ECO:0000269|PubMed:15044016, ECO:0000269|PubMed:7866025}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011071308.1 | 5e-53 | trihelix transcription factor GT-4-like | ||||
Swissprot | Q9FX53 | 6e-38 | TGT1_ARATH; Trihelix transcription factor GT-1 | ||||
TrEMBL | A0A2G9I9G9 | 2e-49 | A0A2G9I9G9_9LAMI; Transcription factor GT-2 | ||||
STRING | Migut.E00236.1.p | 4e-45 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5113 | 21 | 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|