PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

YABBY

Protein Properties

Length: 87aa MW: 9557.62 Da PI: 10.5434

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_69402_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	99	1e-30	13	70	106	163
YABBY 106 deevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163 + ++p++p v++PPek+ r Psaynrf+k+eiqrika+nP+i hreafsaaaknWa + cra_locus_69402_iso_1_len_287_ver_3 13 EPSSPKAPFVVKPPEKKHRLPSAYNRFMKDEIQRIKAANPEIPHREAFSAAAKNWARY 70 456899999***********************************************75 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	6.5E-30	14	70	IPR006780	YABBY protein
SuperFamily	SSF47095	1.15E-9	14	69	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	9.3E-6	24	69	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
ASCXTALPIS SSEPSSPKAP FVVKPPEKKH RLPSAYNRFM KDEIQRIKAA NPEIPHREAF 60 SAAAKNWARY IPNTPQGPPP ASSNNNM

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269\|PubMed:10225997, ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:10535738, ECO:0000269\|PubMed:11714690, ECO:0000269\|PubMed:15598802, ECO:0000269\|Ref.10}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:15598802}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016505118.1	1e-41	PREDICTED: protein CRABS CLAW-like, partial
Swissprot	Q8L925	1e-31	CRC_ARATH; Protein CRABS CLAW
TrEMBL	A0A1S4CVI4	3e-40	A0A1S4CVI4_TOBAC; protein CRABS CLAW-like
STRING	VIT_01s0011g00140.t01	2e-38	(Vitis vinifera)
STRING	XP_009600446.1	4e-38	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA5210	23	39

Publications ? help Back to Top
Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development. Ann. Bot., 2014. 114(7): p. 1535-44 [PMID:24989787] Pfannebecker KC,Lange M,Rupp O,Becker A Seed Plant-Specific Gene Lineages Involved in Carpel Development. Mol. Biol. Evol., 2017. 34(4): p. 925-942 [PMID:28087776] Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation. Nat Commun, 2017. 8(1): p. 1125 [PMID:29066759] Yamaguchi N, et al. Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy. Nat Commun, 2018. 9(1): p. 5290 [PMID:30538233]