PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

NAC

Protein Properties

Length: 122aa MW: 13784.3 Da PI: 10.6886

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_61901_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	102.1	7.7e-32	2	72	57	128
NAM 57 ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk++++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl cra_locus_61901_iso_1_len_363_ver_3 2 EWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKAITT-EGRKVGIKKALVFYIGKAPKGTKTNWIMHEYRL 72 8***********************************.999**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	41.994	1	95	IPR003441	NAC domain
SuperFamily	SSF101941	2.09E-40	2	96	IPR003441	NAC domain
Pfam	PF02365	2.1E-15	3	72	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
XEWYFFSPRD RKYPNGSRPN RVAGSGYWKA TGTDKAITTE GRKVGIKKAL VFYIGKAPKG 60 TKTNWIMHEY RLSEPSRKIG SSRLDDWVLC RIYKKNSSAQ KSNISDLQNK EISHGSSSSS 120 SS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3swm_A	7e-64	2	101	75	174	NAC domain-containing protein 19
3swm_B	7e-64	2	101	75	174	NAC domain-containing protein 19
3swm_C	7e-64	2	101	75	174	NAC domain-containing protein 19
3swm_D	7e-64	2	101	75	174	NAC domain-containing protein 19
3swp_A	7e-64	2	101	75	174	NAC domain-containing protein 19
3swp_B	7e-64	2	101	75	174	NAC domain-containing protein 19
3swp_C	7e-64	2	101	75	174	NAC domain-containing protein 19
3swp_D	7e-64	2	101	75	174	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269\|PubMed:25005917, ECO:0000269\|PubMed:28733419}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269\|PubMed:25005917, ECO:0000269\|PubMed:28733419, ECO:0000269\|PubMed:30610166}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001306107.1	3e-71	JA2-like
Swissprot	A0A3Q7HH64	2e-72	JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBL	M1BP49	1e-68	M1BP49_SOLTU; Uncharacterized protein
STRING	Solyc07g063410.2.1	1e-70	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3122	24	52

Publications ? help Back to Top
Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Du M, et al. MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato. Plant Cell, 2017. 29(8): p. 1883-1906 [PMID:28733419] Liu Y, et al. MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop. Plant Cell, 2019. 31(1): p. 106-127 [PMID:30610166]