PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_560_iso_5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 180aa MW: 20158.2 Da PI: 10.4449 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 105.9 | 3.4e-33 | 14 | 70 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq+Rak+e ekk+ +k rkpylheSRh+hA+rR+RgsgGrF cra_locus_560_iso_5_len_1642_ver_3 14 EEPVYVNAKQYHGILRRRQSRAKAEMEKKV-IKVRKPYLHESRHQHAMRRARGSGGRF 70 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.7E-37 | 12 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.222 | 13 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 7.4E-29 | 15 | 70 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 5.8E-25 | 16 | 38 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 18 | 38 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 5.8E-25 | 47 | 70 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MPQTRVPLPI PMEEEPVYVN AKQYHGILRR RQSRAKAEME KKVIKVRKPY LHESRHQHAM 60 RRARGSGGRF LNTKKLESNG PNSASQEQTA GSTQSGNSSG SEHQTLDSNG NSDYRGGKGS 120 LIQNTYEEHS SSKGNINSDR HPSPYYPIST AGEQARHNFN QESWNMLMMN HVPRGAASSN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-22 | 14 | 78 | 2 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027106866.1 | 3e-64 | nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Refseq | XP_027106867.1 | 3e-64 | nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Refseq | XP_027106868.1 | 2e-64 | nuclear transcription factor Y subunit A-7-like isoform X2 | ||||
Refseq | XP_027113738.1 | 3e-64 | nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Refseq | XP_027113739.1 | 2e-64 | nuclear transcription factor Y subunit A-7-like isoform X2 | ||||
Refseq | XP_027163127.1 | 3e-64 | nuclear transcription factor Y subunit A-7-like | ||||
Swissprot | Q9LXV5 | 4e-36 | NFYA1_ARATH; Nuclear transcription factor Y subunit A-1 | ||||
TrEMBL | A0A068UH68 | 7e-61 | A0A068UH68_COFCA; Uncharacterized protein | ||||
STRING | ERN00900 | 2e-45 | (Amborella trichopoda) | ||||
STRING | VIT_13s0064g00860.t01 | 4e-45 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA11232 | 20 | 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|