![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_5160_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 88aa MW: 10395.1 Da PI: 10.4189 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.4 | 9e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l ++ ++G +W+ ++ g+ R++k+c++rw++yl cra_locus_5160_iso_1_len_411_ver_3 14 KGAWSEEEDNKLRAYILRYGHWNWRQLPKFAGLARCGKSCRLRWLNYL 61 79******************99*************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.1E-22 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.691 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 1.3E-9 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.43E-22 | 15 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.51E-8 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-9 | 65 | 88 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 9.505 | 66 | 88 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MVRSPSIDKN GLRKGAWSEE EDNKLRAYIL RYGHWNWRQL PKFAGLARCG KSCRLRWLNY 60 LKPGLKRGPI TEEEEEMIVK LHEKLGNK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-13 | 12 | 88 | 25 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019158785.1 | 2e-50 | PREDICTED: myb-related protein 308-like | ||||
Swissprot | Q9LDR8 | 7e-36 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | A0A343CX97 | 2e-55 | A0A343CX97_CATRO; Myb17501 | ||||
STRING | EOX99263 | 2e-44 | (Theobroma cacao) |
Publications ? help Back to Top | |||
---|---|---|---|
|