![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_5081_iso_5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 165aa MW: 19189.7 Da PI: 9.5389 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 172.8 | 1e-53 | 6 | 131 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrk 74 lppGfrFhPtdeel+++yLk++++++++++ ++i+evdiyk++Pw+Lp k + +e+ewyfF++rd+ky++g r+ cra_locus_5081_iso_5_len_1497_ver_3 6 LPPGFRFHPTDEELIMYYLKNQATSRPCPV-SIIPEVDIYKFDPWELPGKXEFGENEWYFFTPRDRKYPNGVRP 78 79****************************.89***************988999******************** PP NAM 75 nratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 nra+ sgyWkatg+dk+++s +++ vg+kk Lvfy+g+ pkg k+dW+mheyrl cra_locus_5081_iso_5_len_1497_ver_3 79 NRAAVSGYWKATGTDKSIYS-GSKYVGVKKALVFYQGKPPKGIKSDWIMHEYRL 131 ********************.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.59E-61 | 5 | 136 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.552 | 6 | 153 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.2E-27 | 7 | 131 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009825 | Biological Process | multidimensional cell growth | ||||
GO:0009835 | Biological Process | fruit ripening | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MVGGNLPPGF RFHPTDEELI MYYLKNQATS RPCPVSIIPE VDIYKFDPWE LPGKXEFGEN 60 EWYFFTPRDR KYPNGVRPNR AAVSGYWKAT GTDKSIYSGS KYVGVKKALV FYQGKPPKGI 120 KSDWIMHEYR LIESRSQVPT KQNGSMRVRT FLSSCLFDME YQNIY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 7e-63 | 5 | 158 | 14 | 167 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00221 | DAP | Transfer from AT1G69490 | Download |
![]() |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027096674.1 | 5e-94 | NAC domain-containing protein 2-like | ||||
Swissprot | K4BNG7 | 1e-92 | NAP2_SOLLC; NAC domain-containing protein 2 | ||||
TrEMBL | A0A068TVP6 | 1e-92 | A0A068TVP6_COFCA; Uncharacterized protein | ||||
TrEMBL | A0A2Z5HW71 | 1e-92 | A0A2Z5HW71_IPOBA; NAC3 protein | ||||
STRING | XP_010108694.1 | 1e-92 | (Morus notabilis) |
Publications ? help Back to Top | |||
---|---|---|---|
|