![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_5081_iso_4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 227aa MW: 26396.7 Da PI: 8.5893 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 98.4 | 1.1e-30 | 4 | 77 | 54 | 128 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 +e+ewyfF++rd+ky++g r+nra+ sgyWkatg+dk+++s +++ vg+kk Lvfy+g+ pkg k+dW+mheyr cra_locus_5081_iso_4_len_1634_ver_3 4 GENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKSIYS-GSKYVGVKKALVFYQGKPPKGIKSDWIMHEYR 76 678**************************************.999****************************9 PP NAM 128 l 128 l cra_locus_5081_iso_4_len_1634_ver_3 77 L 77 8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 40.932 | 1 | 105 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.29E-38 | 3 | 105 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.4E-14 | 8 | 77 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009825 | Biological Process | multidimensional cell growth | ||||
GO:0009835 | Biological Process | fruit ripening | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
TEFGENEWYF FTPRDRKYPN GVRPNRAAVS GYWKATGTDK SIYSGSKYVG VKKALVFYQG 60 KPPKGIKSDW IMHEYRLIES RSQVPTKQNG SMRLDDWVLC RIYKKKNLGK LSMDIKVEDQ 120 SQETLVANEL VTSHDDEQQQ QTFKFPRPCS LSHLWEMDYM GSIPQIFGEN SIFDQQNMFM 180 LNNNNNNNGN VNTPRQLGDQ MGNQYSEAMV RFQGNQPVYV NPVFEFQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-49 | 3 | 107 | 68 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-49 | 3 | 107 | 68 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-49 | 3 | 107 | 68 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-49 | 3 | 107 | 68 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-49 | 3 | 107 | 71 | 170 | NAC domain-containing protein 19 |
3swm_B | 2e-49 | 3 | 107 | 71 | 170 | NAC domain-containing protein 19 |
3swm_C | 2e-49 | 3 | 107 | 71 | 170 | NAC domain-containing protein 19 |
3swm_D | 2e-49 | 3 | 107 | 71 | 170 | NAC domain-containing protein 19 |
3swp_A | 2e-49 | 3 | 107 | 71 | 170 | NAC domain-containing protein 19 |
3swp_B | 2e-49 | 3 | 107 | 71 | 170 | NAC domain-containing protein 19 |
3swp_C | 2e-49 | 3 | 107 | 71 | 170 | NAC domain-containing protein 19 |
3swp_D | 2e-49 | 3 | 107 | 71 | 170 | NAC domain-containing protein 19 |
4dul_A | 2e-49 | 3 | 107 | 68 | 167 | NAC domain-containing protein 19 |
4dul_B | 2e-49 | 3 | 107 | 68 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00221 | DAP | Transfer from AT1G69490 | Download |
![]() |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027096674.1 | 1e-105 | NAC domain-containing protein 2-like | ||||
Refseq | XP_027153866.1 | 1e-105 | NAC domain-containing protein 2-like | ||||
Swissprot | K4BWV2 | 2e-90 | NAP1_SOLLC; NAC domain-containing protein 1 | ||||
TrEMBL | A0A068TVP6 | 1e-103 | A0A068TVP6_COFCA; Uncharacterized protein | ||||
STRING | XP_009781251.1 | 5e-91 | (Nicotiana sylvestris) |
Publications ? help Back to Top | |||
---|---|---|---|
|