PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

TCP

Protein Properties

Length: 116aa MW: 13445.6 Da PI: 10.4488

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_46730_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	75.9	1.2e-23	69	116	3	50
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieW 50 g+kdrhsk++T +g+RdRR+Rls+++a++++dLqd+LG+ ++sk ++W cra_locus_46730_iso_1_len_347_ver_3 69 GGKDRHSKVCTVRGLRDRRIRLSVPTAIQLYDLQDRLGLNQPSKVVDW 116 78********************************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51369	26.591	70	116	IPR017887	Transcription factor TCP subgroup
Pfam	PF03634	4.8E-22	70	116	IPR005333	Transcription factor, TCP

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009965	Biological Process	leaf morphogenesis
GO:0030154	Biological Process	cell differentiation
GO:0045962	Biological Process	positive regulation of development, heterochronic

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
XQVDIMNSKE QQDHHYHHQY QTKEEGDHPS DNYNKLSKTS SNPNPSSSSR QWGGGFRNPR 60 IVRVSRTFGG KDRHSKVCTV RGLRDRRIRL SVPTAIQLYD LQDRLGLNQP SKVVDW

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5zkt_A	1e-15	75	116	1	42	Putative transcription factor PCF6
5zkt_B	1e-15	75	116	1	42	Putative transcription factor PCF6
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269\|PubMed:17307931, ECO:0000269\|PubMed:25378179}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00065	PBM	Transfer from AT5G60970	Download

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027102341.1	2e-42	transcription factor TCP5-like isoform X2
Swissprot	Q9FME3	2e-37	TCP5_ARATH; Transcription factor TCP5
TrEMBL	A0A068V843	2e-41	A0A068V843_COFCA; Uncharacterized protein
STRING	Cagra.0083s0006.1.p	6e-42	(Capsella grandiflora)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA821	24	99

Publications ? help Back to Top
Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549]