 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
cra_locus_38068_iso_1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
Family |
Trihelix |
Protein Properties |
Length: 53aa MW: 6331.1 Da PI: 10.1461 |
Description |
Trihelix family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
cra_locus_38068_iso_1 | genome | MPGR | - |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | trihelix | 37.5 | 6e-12 | 1 | 35 | 51 | 86 |
trihelix 51 kekwenlnkrykkikegekkrtsessstcpyfdqle 86
kekwen+nk+++k+k+++kkr s +s+tcpyf+ql
cra_locus_38068_iso_1_len_301_ver_3 1 KEKWENINKYFRKTKDSKKKR-SMDSRTCPYFQQLS 35
79******************8.88899*******96 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor that binds specific DNA sequence. {ECO:0000250}. |