PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_35121_iso_1

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

NAC

Protein Properties

Length: 98aa MW: 10444.3 Da PI: 4.4516

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_35121_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	27.3	1e-08	52	86	1	36
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevike 36 lp+G++F+Ptd+el+ e+L++kvegk+ + + i+e cra_locus_35121_iso_1_len_441_ver_3 52 LPAGVKFDPTDQELI-EHLEAKVEGKESKSHPLIDE 86 799**********.99******9777555655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	9.94E-7	48	90	IPR003441	NAC domain
PROSITE profile	PS51005	9.514	52	98	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 98 aa Download sequence Send to blast
MTSSSNSQLG GSISSSSADL IDAKLEEHQL CGSKHCPGCG HKLEGKPDWV GLPAGVKFDP 60 TDQELIEHLE AKVEGKESKS HPLIDEFIPT IEGEDGIX

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator involved in xylem formation (PubMed:25265867, PubMed:25535195). Promotes the expression of the secondary wall-associated transcription factor MYB46 (PubMed:25265867). Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867, PubMed:25535195). Acts as upstream regulator of NAC101/VND6 and LBD30/ASL19 (PubMed:25535195). {ECO:0000269\|PubMed:25265867, ECO:0000269\|PubMed:25535195}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027157140.1	2e-53	NAC domain-containing protein 75-like, partial
Refseq	XP_028058688.1	1e-51	NAC domain-containing protein 75-like isoform X1
Refseq	XP_028058689.1	1e-51	NAC domain-containing protein 75-like isoform X1
Refseq	XP_028058690.1	1e-51	NAC domain-containing protein 75-like isoform X1
Refseq	XP_028058691.1	1e-51	NAC domain-containing protein 75-like isoform X2
Swissprot	Q9M0F8	1e-43	NAC75_ARATH; NAC domain-containing protein 75
TrEMBL	A0A2Z7BSZ3	3e-50	A0A2Z7BSZ3_9LAMI; NAC domain-containing protein 8
STRING	Migut.K00558.1.p	2e-48	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA4057	24	44

Publications ? help Back to Top
Droc G, et al. OryGenesDB: a database for rice reverse genetics. Nucleic Acids Res., 2006. 34(Database issue): p. D736-40 [PMID:16381969] Sakamoto S,Mitsuda N Reconstitution of a secondary cell wall in a secondary cell wall-deficient Arabidopsis mutant. Plant Cell Physiol., 2015. 56(2): p. 299-310 [PMID:25535195]