![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_3458_iso_8 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 129aa MW: 15442.3 Da PI: 10.7139 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 25.2 | 2.8e-08 | 59 | 91 | 22 | 54 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 +yp++e++++L +++gL+ +q+ +WF N+R + cra_locus_3458_iso_8_len_829_ver_3 59 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 91 69*****************************87 PP | |||||||
2 | ELK | 31 | 5.5e-11 | 12 | 33 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELKh+L+++Y+++++++++E++ cra_locus_3458_iso_8_len_829_ver_3 12 ELKHELKQGYKEKIVDIREEIL 33 9*******************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 6.1E-4 | 12 | 33 | IPR005539 | ELK domain |
Pfam | PF03789 | 2.0E-7 | 12 | 33 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 9.969 | 12 | 32 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 11.677 | 32 | 95 | IPR001356 | Homeobox domain |
SMART | SM00389 | 7.6E-11 | 34 | 99 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.87E-17 | 34 | 102 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 2.65E-9 | 35 | 96 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.8E-26 | 39 | 96 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 1.8E-18 | 52 | 91 | IPR008422 | Homeobox KN domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
XERSLMERVR QELKHELKQG YKEKIVDIRE EILRKRRAGK LPGDTTSLLK AWWQSHSKWP 60 YPTEEDKARL VQETGLQLKQ INNWFINQRK RNWHSNPSSS SSLPRKASVR GTLLIEFHCF 120 QNLYPSWHS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1x2n_A | 9e-14 | 35 | 100 | 8 | 73 | Homeobox protein PKNOX1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May have a role to play in formative events in ovule and embryo morphogenesis. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010519640.1 | 2e-66 | PREDICTED: homeobox protein knotted-1-like 3 | ||||
Refseq | XP_018461395.1 | 5e-67 | PREDICTED: homeobox protein knotted-1-like 6, partial | ||||
Refseq | XP_020265664.1 | 2e-66 | homeobox protein knotted-1-like LET12 | ||||
Swissprot | O22300 | 3e-66 | LET12_SOLLC; Homeobox protein knotted-1-like LET12 | ||||
Swissprot | P48000 | 3e-66 | KNAT3_ARATH; Homeobox protein knotted-1-like 3 | ||||
TrEMBL | A0A438KEK8 | 1e-65 | A0A438KEK8_VITVI; Homeobox protein knotted-1-like 3 | ||||
STRING | Cagra.0628s0006.1.p | 8e-67 | (Capsella grandiflora) |
Publications ? help Back to Top | |||
---|---|---|---|
|