PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

MYB

Protein Properties

Length: 130aa MW: 15504.9 Da PI: 10.4616

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_33217_iso_1	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53	7.9e-17	37	84	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W +eEde+l+ +v lG ++W++ a+ g++R++k+c++rw +yl cra_locus_33217_iso_1_len_389_ver_3 37 KGPWLEEEDERLIAVVSVLGQRRWDALAKASGLKRSGKSCRLRWMNYL 84 79********************************************97 PP
2	Myb_DNA-binding	48.9	1.5e-15	93	130	4	43
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 T+eE+ l+++++kq+G++ W++Iar+++ gRt++++k++ cra_locus_33217_iso_1_len_389_ver_3 93 ITAEEENLIIQLHKQWGNR-WSRIARRLP-GRTDNEIKNY 130 59***************.*****.******97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.031	32	88	IPR017930	Myb domain
SuperFamily	SSF46689	8.79E-28	34	130	IPR009057	Homeodomain-like
SMART	SM00717	8.4E-14	36	86	IPR001005	SANT/Myb domain
Pfam	PF00249	6.1E-15	37	84	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.1E-22	38	91	IPR009057	Homeodomain-like
CDD	cd00167	3.72E-9	39	84	No hit	No description
PROSITE profile	PS51294	18.143	89	130	IPR017930	Myb domain
SMART	SM00717	3.2E-7	89	130	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.9E-21	92	130	IPR009057	Homeodomain-like
Pfam	PF00249	3.7E-13	93	130	IPR001005	SANT/Myb domain
CDD	cd00167	5.65E-10	94	130	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010200	Biological Process	response to chitin
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 130 aa Download sequence Send to blast
XLCHIVSCIR RIIPFPYKFI CKQIMEHQEL AMQELRKGPW LEEEDERLIA VVSVLGQRRW 60 DALAKASGLK RSGKSCRLRW MNYLRPNLKH GHITAEEENL IIQLHKQWGN RWSRIARRLP 120 GRTDNEIKNY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	4e-27	34	130	1	96	MYB PROTO-ONCOGENE PROTEIN
1h88_C	1e-26	28	130	49	150	MYB PROTO-ONCOGENE PROTEIN
1h89_C	1e-26	28	130	49	150	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	8e-27	28	130	18	119	MYB TRANSFORMING PROTEIN
Search in ModeBase

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00406	DAP	Transfer from AT3G53200	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269\|PubMed:9839469}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027069326.1	1e-60	myb-related protein MYBAS1-like
Refseq	XP_027177478.1	5e-60	transcription factor MYB27-like
Swissprot	Q9SCP1	4e-49	MYB27_ARATH; Transcription factor MYB27
TrEMBL	A0A068V3D2	4e-57	A0A068V3D2_COFCA; Uncharacterized protein
STRING	XP_010098805.1	3e-55	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Publications ? help Back to Top
Albert NW, et al. A conserved network of transcriptional activators and repressors regulates anthocyanin pigmentation in eudicots. Plant Cell, 2014. 26(3): p. 962-80 [PMID:24642943]