PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_31747_iso_2

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

NAC

Protein Properties

Length: 112aa MW: 13282.7 Da PI: 10.0432

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_31747_iso_2	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	138.7	3.6e-43	2	110	22	129
NAM 22 kvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 k+++k+++l +vik+vd+yk+ePwdL++ k+++ e++ewyfFs++dkky+tg+r+nratk+g+Wkatg+dk++ cra_locus_31747_iso_2_len_332_ver_3 2 KIASKRIDL-DVIKDVDLYKIEPWDLQElcKISNdEQNEWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAI 74 788999999.99************954555542556******************************** PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129 +s k++l+g++ktLvfykgrap+g k+dW+mheyrle cra_locus_31747_iso_2_len_332_ver_3 75 YS-KHSLIGMRKTLVFYKGRAPNGLKSDWIMHEYRLE 110 .8899****************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	42.03	1	112	IPR003441	NAC domain
SuperFamily	SSF101941	9.29E-43	2	110	IPR003441	NAC domain
Pfam	PF02365	3.9E-17	30	109	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 112 aa Download sequence Send to blast
XKIASKRIDL DVIKDVDLYK IEPWDLQELC KISNDEQNEW YFFSHKDKKY PTGTRTNRAT 60 KAGFWKATGR DKAIYSKHSL IGMRKTLVFY KGRAPNGLKS DWIMHEYRLE TX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-37	2	109	36	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250\|UniProtKB:Q9LVA1, ECO:0000269\|PubMed:16103214, ECO:0000269\|PubMed:25148240}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027080424.1	5e-73	NAC domain-containing protein 7-like
Refseq	XP_027080425.1	5e-73	NAC domain-containing protein 7-like
Refseq	XP_027080426.1	5e-73	NAC domain-containing protein 7-like
Refseq	XP_027080427.1	5e-73	NAC domain-containing protein 7-like
Refseq	XP_027183058.1	5e-73	NAC domain-containing protein 7-like
Swissprot	Q9FWX2	5e-69	NAC7_ARATH; NAC domain-containing protein 7
TrEMBL	A0A2P5BYF4	3e-73	A0A2P5BYF4_PARAD; NAC domain containing protein
STRING	XP_006477251.1	8e-72	(Citrus sinensis)
STRING	evm.model.supercontig_29.118	6e-72	(Carica papaya)

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469]