![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_2810_iso_2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 72aa MW: 8211.18 Da PI: 9.6589 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.8 | 1.3e-18 | 20 | 63 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg W + Ede+l ++v q+G+ +W++Ia++++ gR++k+c++rw+ cra_locus_2810_iso_2_len_879_ver_3 20 RGHWRPAEDEKLRQLVDQYGPQNWNSIAEKLQ-GRSGKSCRLRWY 63 899*****************************.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.352 | 15 | 68 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.09E-15 | 18 | 64 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.1E-13 | 19 | 68 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-19 | 20 | 63 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.2E-17 | 20 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.39E-14 | 23 | 63 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 72 aa Download sequence Send to blast |
MAAAAASDHI HDDDARTCPR GHWRPAEDEK LRQLVDQYGP QNWNSIAEKL QGRSGKSCRL 60 RWYYGKKAKG TI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027093187.1 | 6e-30 | transcription factor MYB101-like | ||||
Refseq | XP_027148060.1 | 7e-30 | transcription factor LAF1-like | ||||
Swissprot | Q6R0C4 | 4e-23 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A068UTV6 | 6e-29 | A0A068UTV6_COFCA; Uncharacterized protein | ||||
TrEMBL | A0A2G9H6B4 | 2e-28 | A0A2G9H6B4_9LAMI; Transcription factor, Myb superfamily | ||||
STRING | XP_008795321.1 | 8e-28 | (Phoenix dactylifera) |
Publications ? help Back to Top | |||
---|---|---|---|
|