![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_2781_iso_4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | CAMTA | ||||||||
Protein Properties | Length: 122aa MW: 14521.7 Da PI: 9.8766 | ||||||||
Description | CAMTA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CG-1 | 169 | 7.2e-53 | 21 | 122 | 3 | 104 |
CG-1 3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvgg 77 + ++rwl++ ei++iL n++k+++t e++ +p sgs++L++rk++ryfrkDG+sw+kkkdgktv+E+hekLKvg+ cra_locus_2781_iso_4_len_701_ver_3 21 EAQHRWLRPAEICEILRNYQKFHITPEPPLKPVSGSVFLFDRKVLRYFRKDGHSWRKKKDGKTVKEAHEKLKVGS 95 569************************************************************************ PP CG-1 78 vevlycyYahseenptfqrrcywlLee 104 +++l+cyYah+een++fqrr+yw+Le+ cra_locus_2781_iso_4_len_701_ver_3 96 IDMLHCYYAHGEENENFQRRSYWMLEQ 122 *************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51437 | 72.296 | 15 | 122 | IPR005559 | CG-1 DNA-binding domain |
SMART | SM01076 | 2.2E-60 | 18 | 122 | IPR005559 | CG-1 DNA-binding domain |
Pfam | PF03859 | 4.6E-46 | 21 | 122 | IPR005559 | CG-1 DNA-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009409 | Biological Process | response to cold | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0071275 | Biological Process | cellular response to aluminum ion | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0005515 | Molecular Function | protein binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MAGSGSQNLG FRLDIKQILC EAQHRWLRPA EICEILRNYQ KFHITPEPPL KPVSGSVFLF 60 DRKVLRYFRK DGHSWRKKKD GKTVKEAHEK LKVGSIDMLH CYYAHGEENE NFQRRSYWML 120 EQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25627216, ECO:0000305|PubMed:11925432}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00043 | PBM | Transfer from AT5G64220 | Download |
![]() |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:25627216}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027106275.1 | 3e-78 | calmodulin-binding transcription activator 2-like isoform X1 | ||||
Swissprot | Q6NPP4 | 4e-67 | CMTA2_ARATH; Calmodulin-binding transcription activator 2 | ||||
TrEMBL | A0A068TQ04 | 7e-77 | A0A068TQ04_COFCA; Uncharacterized protein | ||||
STRING | Migut.B00609.1.p | 5e-72 | (Erythranthe guttata) |
Publications ? help Back to Top | |||
---|---|---|---|
|