![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_14377_iso_4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 53aa MW: 5791.49 Da PI: 9.8944 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 42.7 | 1.3e-13 | 14 | 52 | 1 | 39 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 +g+WT+eEd++lvd++++ G gtW++ ++ g+ R++k+ cra_locus_14377_iso_4_len_309_ver_3 14 KGAWTPEEDKILVDYINKNGHGTWRSLPKLAGLLRCGKS 52 79******************************99*9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.5E-14 | 5 | 52 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 12.832 | 9 | 53 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.59E-9 | 9 | 48 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.2E-11 | 14 | 52 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.72E-6 | 16 | 52 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 53 aa Download sequence Send to blast |
MGRSPCCDKG GVKKGAWTPE EDKILVDYIN KNGHGTWRSL PKLAGLLRCG KSX |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027110329.1 | 2e-28 | transcription factor MYB41-like | ||||
Refseq | XP_027110330.1 | 2e-28 | transcription factor MYB41-like | ||||
Refseq | XP_027161745.1 | 2e-28 | transcription factor MYB41-like | ||||
Swissprot | Q9S9Z2 | 4e-25 | MYB93_ARATH; Transcription factor MYB93 | ||||
TrEMBL | A0A068UAM3 | 1e-26 | A0A068UAM3_COFCA; Uncharacterized protein | ||||
STRING | PGSC0003DMT400016394 | 2e-26 | (Solanum tuberosum) |
Publications ? help Back to Top | |||
---|---|---|---|
|