![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_13899_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 99aa MW: 10807.9 Da PI: 8.5087 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 104.5 | 6.9e-33 | 27 | 83 | 2 | 59 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 ++vrY eC+kNhAa++Gg+avDGC+Efmps geegt+aa++CaACgCHRnFHRre + cra_locus_13899_iso_1_len_535_ver_3 27 RNVRYGECQKNHAAAVGGYAVDGCREFMPS-GEEGTTAAFNCAACGCHRNFHRREIRT 83 579**************************9.999********************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 7.0E-27 | 1 | 83 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 2.6E-30 | 28 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.7E-27 | 30 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.487 | 31 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
MKKRQVVIRR SEDHSSRNSA NSSFTVRNVR YGECQKNHAA AVGGYAVDGC REFMPSGEEG 60 TTAAFNCAAC GCHRNFHRRE IRTEEVSEGS SPPSVSNAA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027076245.1 | 5e-50 | mini zinc finger protein 2-like | ||||
Refseq | XP_027154448.1 | 5e-50 | mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 2e-40 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A068U165 | 1e-48 | A0A068U165_COFCA; Uncharacterized protein | ||||
STRING | EOY03457 | 6e-45 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1105 | 24 | 86 |
Publications ? help Back to Top | |||
---|---|---|---|
|