![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_11409_iso_5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 120aa MW: 13980 Da PI: 9.977 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 162.5 | 2.6e-50 | 2 | 77 | 1 | 76 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76 ++++r ptwkErEnnkrRERrRRaiaa i+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrk ++ cra_locus_11409_iso_5_len_566_ver_3 2 TSGTRLPTWKERENNKRRERRRRAIAANIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKDASQW 77 5899******************************************************************998876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 7.6E-47 | 3 | 76 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MTSGTRLPTW KERENNKRRE RRRRAIAANI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG 60 WTVEPDGTTY RKDASQWTEW ISWGDQQRQV HAPLINQVLE PPTTQVLHPP LSQVQLLLML |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 2e-20 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 2e-20 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 2e-20 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 2e-20 | 6 | 72 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027127193.1 | 1e-46 | BES1/BZR1 homolog protein 4-like | ||||
Swissprot | Q9ZV88 | 1e-28 | BEH4_ARATH; BES1/BZR1 homolog protein 4 | ||||
TrEMBL | A0A068UCW3 | 4e-45 | A0A068UCW3_COFCA; Uncharacterized protein | ||||
TrEMBL | A0A2P5WYB4 | 1e-45 | A0A2P5WYB4_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.002G052400.1 | 3e-44 | (Gossypium raimondii) |