PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

augustus_masked-scaffold13692-abinit-gene-0.0-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

NAC

Protein Properties

Length: 62aa MW: 7159.41 Da PI: 4.5381

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
augustus_masked-scaffold13692-abinit-gene-0.0-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	52.3	1.8e-16	15	60	1	47
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdL 47 lppGfrF+Ptdeelv +yLk kv + +l++ +vi+e++++k++Pw+L augustus_masked-scaffold13692-abinit-gene-0.0-mRNA-1 15 LPPGFRFQPTDEELVFQYLKCKVFSCPLPA-SVIPEINVCKFDPWEL 60 79**************************.99***********9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	4.05E-18	14	61	IPR003441	NAC domain
PROSITE profile	PS51005	19.326	15	62	IPR003441	NAC domain
Pfam	PF02365	3.4E-7	16	49	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MDKLSFTQEG VTRILPPGFR FQPTDEELVF QYLKCKVFSC PLPASVIPEI NVCKFDPWEL 60 LP

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078, ECO:0000269\|PubMed:24442717}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269\|PubMed:21673078}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023875264.1	4e-39	NAC domain-containing protein 83-like
Swissprot	Q9FY93	8e-21	NAC83_ARATH; NAC domain-containing protein 83
TrEMBL	A0A2N9J1V6	7e-33	A0A2N9J1V6_FAGSY; Uncharacterized protein
TrEMBL	A0A2Z6NNX1	4e-32	A0A2Z6NNX1_TRISU; Uncharacterized protein
STRING	AET05028	1e-31	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF21137	4	4

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13180.1	3e-23	NAC domain containing protein 83

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]