 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
augustus_masked-scaffold10132-abinit-gene-0.0-mRNA-1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
Family |
HSF |
Protein Properties |
Length: 111aa MW: 11983.4 Da PI: 5.5299 |
Description |
HSF family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
augustus_masked-scaffold10132-abinit-gene-0.0-mRNA-1 | genome | THGP | View Nucleic Acid |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | HSF_DNA-bind | 48.9 | 1.8e-15 | 41 | 87 | 2 | 48 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT- CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhs 48
Fl+k+y++++d++++ ++sws ++nsfvv+++ efa+++LpkyFkh+
augustus_masked-scaffold10132-abinit-gene-0.0-mRNA-1 41 FLSKTYDMVDDPATDPILSWSPTNNSFVVWNPPEFARDLLPKYFKHR 87
9********************999**********************6 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0005634 | Cellular Component | nucleus |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:7948881}. |
Publications
? help Back to Top |
- Hsu SF,Jinn TL
AtHSBP functions in seed development and the motif is required for subcellular localization and interaction with AtHSFs. Plant Signal Behav, 2010. 5(8): p. 1042-4 [PMID:20657173] - Liu HC,Charng YY
Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development. Plant Physiol., 2013. 163(1): p. 276-90 [PMID:23832625] - Li S, et al.
HEAT-INDUCED TAS1 TARGET1 Mediates Thermotolerance via HEAT STRESS TRANSCRIPTION FACTOR A1a-Directed Pathways in Arabidopsis. Plant Cell, 2014. 26(4): p. 1764-1780 [PMID:24728648] - Muench M,Hsin CH,Ferber E,Berger S,Mueller MJ
Reactive electrophilic oxylipins trigger a heat stress-like response through HSFA1 transcription factors. J. Exp. Bot., 2016. 67(21): p. 6139-6148 [PMID:27811081]
|