PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00498-abinit-gene-0.4-mRNA-1
Organism
Castanea mollissima
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 168aa    MW: 19468.4 Da    PI: 9.8097
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00498-abinit-gene-0.4-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.51.5e-50201462128
                                                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekew 58 
                                                            pGfrFhPtdeelv +yL++kv++k++ l + ik++diyk++PwdLp + + +ekew
  augustus_masked-scaffold00498-abinit-gene-0.4-mRNA-1  20 LPGFRFHPTDEELVGFYLQRKVDKKPICL-DLIKHIDIYKHDPWDLP-TGSVGEKEW 74 
                                                           69************************999.99***************.4456899** PP

                                                   NAM  59 yfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kgelvglkktLvfykgra 113
                                                           yfF++r kky+++ r+nr+t sg+Wkatg dk+++s    +e +glkk+Lv+y+g+a
  augustus_masked-scaffold00498-abinit-gene-0.4-mRNA-1  75 YFFCRRGKKYKNSVRPNRVTGSGFWKATGIDKAIYSVkePHECIGLKKSLVYYRGSA 131
                                                           ***********************************97545566************** PP

                                                   NAM 114 pkgektdWvmheyrl 128
                                                            kg+ktdW+mhe+rl
  augustus_masked-scaffold00498-abinit-gene-0.4-mRNA-1 132 GKGTKTDWMMHEFRL 146
                                                           *************98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5214154IPR003441NAC domain
PROSITE profilePS5100548.67419162IPR003441NAC domain
PfamPF023651.3E-2621146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MEVKKMSVLV NGCKDDEDFL PGFRFHPTDE ELVGFYLQRK VDKKPICLDL IKHIDIYKHD  60
PWDLPTGSVG EKEWYFFCRR GKKYKNSVRP NRVTGSGFWK ATGIDKAIYS VKEPHECIGL  120
KKSLVYYRGS AGKGTKTDWM MHEFRLPANK STNPSVTRNT TQEAVRFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-442114622145NAC domain-containing protein 19
3swm_B1e-442114622145NAC domain-containing protein 19
3swm_C1e-442114622145NAC domain-containing protein 19
3swm_D1e-442114622145NAC domain-containing protein 19
3swp_A1e-442114622145NAC domain-containing protein 19
3swp_B1e-442114622145NAC domain-containing protein 19
3swp_C1e-442114622145NAC domain-containing protein 19
3swp_D1e-442114622145NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023896588.11e-117transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK552e-71NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A2N9EHV81e-101A0A2N9EHV8_FAGSY; Uncharacterized protein
STRINGXP_010272267.14e-83(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.19e-74NAC domain containing protein 42
Publications ? help Back to Top
  1. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  2. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  3. Shahnejat-Bushehri S, et al.
    Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato.
    Front Plant Sci, 2017. 8: p. 214
    [PMID:28326087]
  4. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  5. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]