PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zpz_sc04136.1.g00020.1.am.mk

Organism

Zoysia pacifica

Taxonomic ID

1070856

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

M-type_MADS

Protein Properties

Length: 308aa MW: 33313.7 Da PI: 4.8499

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zpz_sc04136.1.g00020.1.am.mk	genome	ZGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	98.9	2e-31	157	207	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s Zpz_sc04136.1.g00020.1.am.mk 157 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCS 207 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	5.6E-41	149	208	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.277	149	209	IPR002100	Transcription factor, MADS-box
CDD	cd00265	8.51E-41	150	208	No hit	No description
SuperFamily	SSF55455	1.83E-29	150	213	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-32	151	171	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	151	205	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.4E-26	158	205	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-32	171	186	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-32	186	207	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 308 aa Download sequence Send to blast
MIGTAPSVSR GRTDSDSEER DLPETGYGGP RLGFPPSLCF AGNGNLLSGP LAPTGCFAER 60 ARSLTSAQLL PPVHEMSPTT ITTTVLLVEA CLQLPSLSSS LLALLLSCLG CLLGESDLAA 120 EAEGSWGGKG KQQQQQQEEA PPPPPATAMG RGRVELKRIE NKINRQVTFA KRRNGLLKKA 180 YELSVLCDAE VALIIFSTRG KLYEFCSTQR SARPAIGEDE KQVAFLEYWL MDPELGFGGV 240 PGRDPGDTFG FRLEESNQVL WQQAWEHGER QPEVQPPQPQ LHGGNGFFHP LDAAGETTLQ 300 IGDMPKSI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	3e-19	149	208	1	60	MEF2C
5f28_B	3e-19	149	208	1	60	MEF2C
5f28_C	3e-19	149	208	1	60	MEF2C
5f28_D	3e-19	149	208	1	60	MEF2C
6byy_A	3e-19	149	208	1	60	MEF2 CHIMERA
6byy_B	3e-19	149	208	1	60	MEF2 CHIMERA
6byy_C	3e-19	149	208	1	60	MEF2 CHIMERA
6byy_D	3e-19	149	208	1	60	MEF2 CHIMERA
6bz1_A	3e-19	149	208	1	60	MEF2 CHIMERA
6bz1_B	3e-19	149	208	1	60	MEF2 CHIMERA
6bz1_C	3e-19	149	208	1	60	MEF2 CHIMERA
6bz1_D	3e-19	149	208	1	60	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269\|PubMed:9339904, ECO:0000269\|Ref.10}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Zpz_sc04136.1.g00020.1.am.mk

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ430692	2e-84	AJ430692.1 Zea mays mRNA for putative MADS-domain transcription factor (m6 gene).
GenBank	BT033360	2e-84	BT033360.1 Zea mays full-length cDNA clone ZM_BFb0092L03 mRNA, complete cds.
GenBank	BT042605	2e-84	BT042605.1 Zea mays full-length cDNA clone ZM_BFb0367C04 mRNA, complete cds.
GenBank	EU959867	2e-84	EU959867.1 Zea mays clone 220179 SRF-type transcription factor family protein mRNA, complete cds.
GenBank	EU960711	2e-84	EU960711.1 Zea mays clone 227805 SRF-type transcription factor family protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020194872.1	1e-51	MADS-box transcription factor 7
Swissprot	P0C5B0	4e-48	MADS7_ORYSI; MADS-box transcription factor 7
Swissprot	Q0J466	4e-48	MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBL	A0A0E0E0W9	8e-54	A0A0E0E0W9_9ORYZ; Uncharacterized protein
TrEMBL	A0A0E0LX97	9e-54	A0A0E0LX97_ORYPU; Uncharacterized protein
STRING	BRADI3G41260.1	6e-50	(Brachypodium distachyon)
STRING	OMERI06G12630.1	3e-49	(Oryza meridionalis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP28144	3	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	2e-35	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Shitsukawa N, et al. Genetic and epigenetic alteration among three homoeologous genes of a class E MADS box gene in hexaploid wheat. Plant Cell, 2007. 19(6): p. 1723-37 [PMID:17586655] Bai X,Wang Q,Chu C Excision of a selective marker in transgenic rice using a novel Cre/loxP system controlled by a floral specific promoter. Transgenic Res., 2008. 17(6): p. 1035-43 [PMID:18437520] Qu L, et al. Expression pattern and functional analysis of a MADS-box gene M79 from rice. Sci. China, C, Life Sci., 2001. 44(2): p. 161-9 [PMID:18726433] Cui R, et al. Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa). Plant J., 2010. 61(5): p. 767-81 [PMID:20003164] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Tang X, et al. Global gene profiling of laser-captured pollen mother cells indicates molecular pathways and gene subfamilies involved in rice meiosis. Plant Physiol., 2010. 154(4): p. 1855-70 [PMID:20959420] Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice. Theor. Appl. Genet., 2011. 122(8): p. 1489-96 [PMID:21327937] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yoshida H Is the lodicule a petal: molecular evidence? Plant Sci., 2012. 184: p. 121-8 [PMID:22284716] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Wong CE,Singh MB,Bhalla PL Novel members of the AGAMOUS LIKE 6 subfamily of MIKCC-type MADS-box genes in soybean. BMC Plant Biol., 2013. 13: p. 105 [PMID:23870482] Hu Z,Ding X,Hu S,Sun Y,Xia L Tissue-specifically regulated site-specific excision of selectable marker genes in bivalent insecticidal, genetically-modified rice. Biotechnol. Lett., 2013. 35(12): p. 2177-83 [PMID:23974493] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Dreni L,Zhang D Flower development: the evolutionary history and functions of the AGL6 subfamily MADS-box genes. J. Exp. Bot., 2016. 67(6): p. 1625-38 [PMID:26956504]